SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g00790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g00790): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g00790

Feature Type:gene_model
Chromosome:Gm05
Start:435887
stop:438624
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma05g00790
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18680AT Annotation by Michelle Graham. TAIR10: HNH endonuclease domain-containing protein | chr1:6432133-6433434 REVERSE LENGTH=186 SoyBaseE_val: 5.00E-81ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004519GO-mf Annotation by Michelle Graham. GO Molecular Function: endonuclease activity SoyBaseN/AISS
PF01844PFAM HNH endonuclease JGI ISS
UniRef100_B9RLU4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Endonuclease, putative n=1 Tax=Ricinus communis RepID=B9RLU4_RICCO SoyBaseE_val: 2.00E-82ISS
UniRef100_I1JZM0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZM0_SOYBN SoyBaseE_val: 1.00E-116ISS

Expression Patterns of Glyma05g00790
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g00790 not represented in the dataset
Glyma05g00790 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g00790
ParalogEvidenceComments
Glyma17g11120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g00790 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g024300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma05g00790
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma05g00790
>Glyma05g00790.1   sequence type=CDS   gene model=Glyma05g00790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTTCGTCCTCTCCACAACGTTCTCGCGGCGACGGCGAGAAAAGGCCCAGATTTTTCGACTCAAACGCGAAGGCCATCTGTTGGTCTAAAGCTGATACTGTCCCCGGCCGTCACCCTGAGAGGTGGCGCAAAGACGCCGCCGGTAACGTTGTCTGCAAACGTTTCTTCAACTGCATCGGCTGCCTCTGCTACGAGTACGATCACATCATTCCCTTTTCCAAAGGTGGTGAGTCCACTGCGGATAATTGCCAAATACTTCAATCAAGAGTTAACAGACTCAAATCGGACAAATATAACATTGATTCGGATCAATTGAAAGACTACTCCTGTGAGGTTAATTTTACTGATAAGGAACTTGATATTATTGAGATGGCTGTTTATGGCGATGTGATGCGGCCAGGAAACCAGTGTCGTTGCAGAACTATTGCTGAAAAGCTTGGCAAATTTAAACCAAAGGATGACACAGATGCATGTAAGTTGCCATAG
Predicted protein sequences of Glyma05g00790
>Glyma05g00790.1   sequence type=predicted peptide   gene model=Glyma05g00790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSSSPQRSRGDGEKRPRFFDSNAKAICWSKADTVPGRHPERWRKDAAGNVVCKRFFNCIGCLCYEYDHIIPFSKGGESTADNCQILQSRVNRLKSDKYNIDSDQLKDYSCEVNFTDKELDIIEMAVYGDVMRPGNQCRCRTIAEKLGKFKPKDDTDACKLP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo