Glyma05g00771 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma05g00771

Feature Type:	gene_model
Chromosome:	Gm05
Start:	429944
stop:	431758
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g00771

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G03350	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF538 \| chr2:1019733-1021071 REVERSE LENGTH=179	SoyBase	E_val: 2.00E-55	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
PF04398	PFAM	Protein of unknown function, DUF538	JGI		ISS
UniRef100_Q10Q43	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cp protein, putative n=3 Tax=Oryza sativa RepID=Q10Q43_ORYSJ	SoyBase	E_val: 1.00E-48	ISS
UniRef100_UPI0002339B5B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339B5B related cluster n=1 Tax=unknown RepID=UPI0002339B5B	SoyBase	E_val: 3.00E-90	ISS

Expression Patterns of Glyma05g00771

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g00771 not represented in the dataset	Glyma05g00771 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma05g00771

Paralog	Evidence	Comments
Glyma17g11140	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma05g00771 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g024100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g00771

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g00771

Limit To All Plant Sequences

>Glyma05g00771.1   sequence type=CDS   gene model=Glyma05g00771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAAAGCTCTAACTAAACTGGGTAGCGCTTGGATCTCCAAGAAAGCCAAGGCAGAGATTTCCCACATAACCGATGACCTGTCATCTCTCCCAAATACAGTCGAAGAGAAGGCAAAACTTTTTATCAACAAGCTCAAAGGTAAAACCCAGAAAGCCTTGCCTGATCTCCTTCGAGAGTACAACCTTCCAACCGGTCTGTTCCCTCGCAACATAACAAGCTACGAATTTGATGCATCAAAGGGAAAGTTGATAGTGTACTTGTCCTCTCCGTGTGAGGTATGCTTCAAGGACTCATCCATTGTGAGGTATGCAAATCGTGTTAAAGGGTCATTATCAAAGGGGAAGCTCACTGTGACTAGTGTTGCTGTTGAGAGTTACAAGTCTGACAAAGTATGGTTCGCTACCATTGAGTAA

Predicted protein sequences of Glyma05g00771

Limit To All Plant Sequences

>Glyma05g00771.1   sequence type=predicted peptide   gene model=Glyma05g00771   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKALTKLGSAWISKKAKAEISHITDDLSSLPNTVEEKAKLFINKLKGKTQKALPDLLREYNLPTGLFPRNITSYEFDASKGKLIVYLSSPCEVCFKDSSIVRYANRVKGSLSKGKLTVTSVAVESYKSDKVWFATIE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain