SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma05g00521

Feature Type:gene_model
Chromosome:Gm05
Start:249557
stop:250202
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G07990AT Annotation by Michelle Graham. TAIR10: Cytochrome P450 superfamily protein | chr5:2560437-2562859 FORWARD LENGTH=513 SoyBaseE_val: 5.00E-69ISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009813GO-bp Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0016711GO-mf Annotation by Michelle Graham. GO Molecular Function: flavonoid 3'-monooxygenase activity SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR24298Panther FAMILY NOT NAMED JGI ISS
PTHR24298:SF44Panther JGI ISS
PF00067PFAM Cytochrome P450 JGI ISS
UniRef100_Q84U81UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flavonoid 3'-hydroxylase (Fragment) n=1 Tax=Glycine max RepID=Q84U81_SOYBN SoyBaseE_val: 5.00E-78ISS
UniRef100_UPI0002339B51UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339B51 related cluster n=1 Tax=unknown RepID=UPI0002339B51 SoyBaseE_val: 4.00E-118ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g00521 not represented in the dataset

Glyma05g00521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.05g022000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma05g00521.1   sequence type=CDS   gene model=Glyma05g00521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTAGTGCAGGGATAGATACATCATCAAACACAATAGACTGGATAATTGCAAAACTTATAAAGAACCCAAGAATTATGGTCCAAGTCCAACAAGAGTTGAATATTGTTGTGGGACAGGATAGGCTTGTGACTGAACTAGATTTGCCCCACCTCCCTTACTTGCAAGTTGTGGTGAAGGAAACGTTACATCTCCACCCACCAACCCCTCTTTCCCTCCCACGACTTGCTAAAAATAGTTGTGAGATATTCAATTATCACATCCCCAAAAGTGCAACTCTCTTGATTAATGTTTGGGCCATAGGACGTGATCTTAAGGAATGGCTTGACCTATTGGAGTTCAAGCCTGAAAGGTTTTTTCTCGATGGTGAGAAGGTTGATGTTGACGTTAAAGGTAATAACTTTGAGCTTCTACCTTTTGGTGTTGGGCGTAAAATATGTGTTGGTATGAGCTTAGGCCTAAAAGCAATTCCTCTTTCCTTCCACCCTCACCCTAGGCTCTCACAACATGTATATTCATCATTGACACCATGA

>Glyma05g00521.1   sequence type=predicted peptide   gene model=Glyma05g00521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFSAGIDTSSNTIDWIIAKLIKNPRIMVQVQQELNIVVGQDRLVTELDLPHLPYLQVVVKETLHLHPPTPLSLPRLAKNSCEIFNYHIPKSATLLINVWAIGRDLKEWLDLLEFKPERFFLDGEKVDVDVKGNNFELLPFGVGRKICVGMSLGLKAIPLSFHPHPRLSQHVYSSLTP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo