Report for Sequence Feature Glyma05g00490
Feature Type: gene_model
Chromosome: Gm05
Start: 231109
stop: 234908
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma05g00490
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G05010 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function, transmembrane-40 | chr3:1389603-1391462 FORWARD LENGTH=300
SoyBase E_val: 8.00E-115 ISS
GO:0002237 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin
SoyBase N/A ISS
GO:0010015 GO-bp
Annotation by Michelle Graham. GO Biological Process: root morphogenesis
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG4536
KOG
Predicted membrane protein
JGI ISS
PTHR15876 Panther
TPRA-40 RELATED
JGI ISS
PTHR15876:SF9 Panther
JGI ISS
PF10160 PFAM
Predicted membrane protein
JGI ISS
UniRef100_I1JZJ6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZJ6_SOYBN
SoyBase E_val: 0 ISS
UniRef100_Q94BV6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AT5g27210/T21B4_120 n=1 Tax=Arabidopsis thaliana RepID=Q94BV6_ARATH
SoyBase E_val: 3.00E-100 ISS
Expression Patterns of Glyma05g00490
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma05g00490
Paralog Evidence Comments
Glyma17g08561 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma05g00490 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.05g021700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma05g00490
Coding sequences of Glyma05g00490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma05g00490.2 sequence type=CDS gene model=Glyma05g00490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCAACGAGCATCGAAGACCAAGCTCTGTCGTCAACTGGCAGCGATCTGAAGTGCGACGGGTACGGCATCTCCCTTGTCGTTTCGTCGGTTTTGTTCGTTCTGTATCTTGCGGTGCACGCCAAGAAGAACCTCAACAGCCTCTGTCGTCGAGGCTCCTATGTTGTCGTTTCCTATTTTGCCCTCCTCTGGCTCGTCACGCTGTTGAACCTCGCATGGTCTTTTCTTCAGGCATGGCAGTGCTCTCCTGGAAAGGAGGTTGCATGGAATCTCCTGTCATTATTTACAGCATCTGGTATGTTGTGTCTAGAGATAAGCTTGATGGCTTTCTTGCTGAAGGATAACTACATGAATGGCATGGAAGCTCTAGCACACTCTTTCCTTGCAACAGGAATTATTGTCTTTGTGGACACCCTTCTTAAGGCAATATATGTTTTTGGAGTTGGGGTCCCATTGTTCAATCACAATGTTAGAAGTACTCATACGATCAAGTGGAGTTTGTGGATAATACATAAATTATTGCTTGCTGCAGCATATGGCTTCATTTTATTTGCAAATTTCTCCAAATGGAGAGAGAAGCTGCCTCCAAGGCCATCTTTCCACAACTATGTTGCTGTAATGTTTGTCTTCAGTGTGATTACCCTGTTTGCTTGTGGACTAGCAGCAATTGACGCTGGACTTGGCAATTGGTTGTATGATCTCACTGTGCTTTGTTATCACTCTTTGTATCTTCCATTTCTTTACGTAACTTTTCTTGCAGATTTTTTCCAGGAGGAGGATTTCCTTTTGGACAACGCATATTACTCCGAGATGAAAGATGCCGGATTCTTTGATGCTGACTGGGAATAA
Predicted protein sequences of Glyma05g00490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma05g00490.2 sequence type=predicted peptide gene model=Glyma05g00490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSTSIEDQALSSTGSDLKCDGYGISLVVSSVLFVLYLAVHAKKNLNSLCRRGSYVVVSYFALLWLVTLLNLAWSFLQAWQCSPGKEVAWNLLSLFTASGMLCLEISLMAFLLKDNYMNGMEALAHSFLATGIIVFVDTLLKAIYVFGVGVPLFNHNVRSTHTIKWSLWIIHKLLLAAAYGFILFANFSKWREKLPPRPSFHNYVAVMFVFSVITLFACGLAAIDAGLGNWLYDLTVLCYHSLYLPFLYVTFLADFFQEEDFLLDNAYYSEMKDAGFFDADWE*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
