Glyma05g00310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma05g00310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma05g00310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma05g00310

Feature Type:	gene_model
Chromosome:	Gm05
Start:	123346
stop:	123582
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma05g00310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G04400	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L14p/L23e family protein \| chr3:1167339-1168308 FORWARD LENGTH=140	SoyBase	E_val: 1.00E-34	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0022625	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PTHR11761	Panther	50S RIBOSOMAL PROTEIN L14-RELATED	JGI		ISS
PTHR11761:SF4	Panther	50S RIBOSOMAL PROTEIN L14P	JGI		ISS
PF00238	PFAM	Ribosomal protein L14p/L23e	JGI		ISS
UniRef100_I1JZH4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JZH4_SOYBN	SoyBase	E_val: 6.00E-49	ISS
UniRef100_P49690	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L23 n=3 Tax=Arabidopsis RepID=RL23_ARATH	SoyBase	E_val: 5.00E-32	ISS

Expression Patterns of Glyma05g00310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma05g00310 not represented in the dataset	Glyma05g00310 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma05g00310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.05g020000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma05g00310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma05g00310

Limit To All Plant Sequences

>Glyma05g00310.1   sequence type=CDS   gene model=Glyma05g00310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCGTCAAGAAGGGAAAGCCTGATCTCCGTAAGGTGTTGCCTGTTGTCATCGTCCTTCAGCACAGGCCATGGCACAGAAAGGATGGCGTTTTACATGCATTTCGAAGATTATGTTGGGTCACAGTGAATCCCAAGGGTGAAATGAAAGGATCTACTATCACTGGTCCAATTGGGAAGGAGTGTGCTAATCTCTGGCCGAGGATTGCAAGAGTTGCCAATGCTATTGTTTAG

Predicted protein sequences of Glyma05g00310

Limit To All Plant Sequences

>Glyma05g00310.1   sequence type=predicted peptide   gene model=Glyma05g00310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATVKKGKPDLRKVLPVVIVLQHRPWHRKDGVLHAFRRLCWVTVNPKGEMKGSTITGPIGKECANLWPRIARVANAIV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain