SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G11175 | AT | Annotation by Michelle Graham. TAIR10: Nucleic acid-binding, OB-fold-like protein | chr4:6818162-6818806 FORWARD LENGTH=141 | SoyBase | E_val: 6.00E-32 | ISS |
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
| GO:0006413 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translational initiation | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| GO:0003743 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity | SoyBase | N/A | ISS |
| PF01176 | PFAM | Translation initiation factor 1A / IF-1 | JGI | ISS | |
| UniRef100_I1JZH0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZH0_SOYBN | SoyBase | E_val: 9.00E-99 | ISS |
| UniRef100_Q94KR7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Translation initiation factor IF-1, chloroplastic n=1 Tax=Glycine max RepID=IF1C_SOYBN | SoyBase | E_val: 6.00E-66 | ISS |
|
Glyma05g00260 not represented in the dataset |
Glyma05g00260 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma17g08790 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.05g019600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma05g00260.1 sequence type=CDS gene model=Glyma05g00260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTCCCATCATCATCTCCCACCTCACTCCACACCCCAATCCTTCACCACCGTTACTGTCACCACCCTACACCGTCCCGCACCCAGTTCTCCCCTCTCACCCTCCCACCCTTCCGTCACACCCTCTCCTTCCTCGTCCCTCCGCCGCTTCTTCCGGCTGCGCGCGCCATCCCCGCCGCATCCGCCGCGAAGGGCGACAAGTCCGGCGAGCAGAAGTGGGTCCTCGAGGGTCTGGTCATGGAGTCCCTCCCGAACGGCATGTTCCGCGTGCGCCTTGACAACGAGGACTTGATTCTAGGCTACATCTCCGGCAAAATCCGCAAGAACTACGTTCGGATCCTCCCCGGCGATAGAGTCAAGGTCGAGGTCACCCGCTACGACTCCTCCAAAGGACGCATCGTTTACAGGCTCCGCAGCAGCACCCCCTCCTAA
>Glyma05g00260.1 sequence type=predicted peptide gene model=Glyma05g00260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFPSSSPTSLHTPILHHRYCHHPTPSRTQFSPLTLPPFRHTLSFLVPPPLLPAARAIPAASAAKGDKSGEQKWVLEGLVMESLPNGMFRVRLDNEDLILGYISGKIRKNYVRILPGDRVKVEVTRYDSSKGRIVYRLRSSTPS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
