Report for Sequence Feature Glyma04g43250
Feature Type: gene_model
Chromosome: Gm04
Start: 48859086
stop: 48861185
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g43250
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G14320 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein S13/S18 family | chr5:4617839-4618772 REVERSE LENGTH=169
SoyBase E_val: 3.00E-80 ISS
GO:0006354 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009773 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0019684 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction
SoyBase N/A ISS
GO:0035304 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation
SoyBase N/A ISS
GO:0042254 GO-bp
Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0009941 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope
SoyBase N/A ISS
GO:0015935 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit
SoyBase N/A ISS
GO:0003676 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding
SoyBase N/A ISS
GO:0003723 GO-mf
Annotation by Michelle Graham. GO Molecular Function: RNA binding
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG3311
KOG
Ribosomal protein S18
JGI ISS
PTHR10871 Panther
30S/40S RIBOSOMAL PROTEIN
JGI ISS
PTHR10871:SF1 Panther
30S RIBOSOMAL PROTEIN S13
JGI ISS
PF00416 PFAM
Ribosomal protein S13/S18
JGI ISS
UniRef100_C6T1G9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1G9_SOYBN
SoyBase E_val: 2.00E-113 ISS
UniRef100_G7J3M7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S13 n=1 Tax=Medicago truncatula RepID=G7J3M7_MEDTR
SoyBase E_val: 3.00E-90 ISS
Expression Patterns of Glyma04g43250
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g43250
Paralog Evidence Comments
Glyma06g11450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g43250 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g253300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g43250
Coding sequences of Glyma04g43250
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g43250.1 sequence type=CDS gene model=Glyma04g43250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCACAAACGCTGGCAATGCCCGTGGCACCTTCGCTAGCTATCATCTCCAATTCTCGCCTCTCCAACACACTCTCCGTTCCCGTTCTGAACAAACCAAAGGTTCAAGGGTCAAGCATCAAGTGCGTTCGTGTTGGTGGTGTGGAGATTCCGAACAACAAGCGAATCGAGTACTCGCTGCAGTACATTCATGGAGTTGGAAGGACCAGAGCGAAACAGATTCTCTGTGATATCCAAATGGATAATAAAATCACGAAGGAACTCACTGAGGAGGAGCTAATCACACTCAGGGACGAGGTCTCCAAATACATGATTGAAGGCGACCTGAGACGGTTCAATGCGGTTAATATAAAGAGACTGAAGGATATTCAGTGCTACAGAGGAATAAGGCATATTCAGGGGCTTCCTTGCAGAGGCCAGCGAACCAAGAATAATTGCAGAACCTTGAAGGGTAAGAAGGTTGCCATTGCCGGTAAAAAGAAAAAGTAA
Predicted protein sequences of Glyma04g43250
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g43250.1 sequence type=predicted peptide gene model=Glyma04g43250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAQTLAMPVAPSLAIISNSRLSNTLSVPVLNKPKVQGSSIKCVRVGGVEIPNNKRIEYSLQYIHGVGRTRAKQILCDIQMDNKITKELTEEELITLRDEVSKYMIEGDLRRFNAVNIKRLKDIQCYRGIRHIQGLPCRGQRTKNNCRTLKGKKVAIAGKKKK*