SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g42870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g42870): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g42870

Feature Type:gene_model
Chromosome:Gm04
Start:48496191
stop:48498043
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G44575AT Annotation by Michelle Graham. TAIR10: Chlorophyll A-B binding family protein | chr1:16871768-16873194 FORWARD LENGTH=265 SoyBaseE_val: 5.00E-105ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0010196GO-bp Annotation by Michelle Graham. GO Biological Process: nonphotochemical quenching SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0080167GO-bp Annotation by Michelle Graham. GO Biological Process: response to karrikin SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009517GO-cc Annotation by Michelle Graham. GO Cellular Compartment: PSII associated light-harvesting complex II SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
GO:0051738GO-mf Annotation by Michelle Graham. GO Molecular Function: xanthophyll binding SoyBaseN/AISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_G7J4F9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II 22 kDa protein n=1 Tax=Medicago truncatula RepID=G7J4F9_MEDTR SoyBaseE_val: 1.00E-148ISS
UniRef100_I1JZ64UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZ64_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g42870 not represented in the dataset

Glyma04g42870 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g11890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g249700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g42870.1   sequence type=CDS   gene model=Glyma04g42870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCAAACCATGTTGCTCATGTCTAGTGTCTCTAGCAGTTATTCCGTGGATTTGAAGAAAGACCTTTTCCTCCAATTGCAGAGTCAAAGTTTAAGGCCTAAGTTCTCTCAGCTCTCATTCAACCCACTTCCATCATCAACTTCTTCCTTTTCTTCACCCCGTACATTCACAACTCTGGCCCTCTTCAAATCTAAGACCAAAGCCGCTCCTGCTAAGACTAAGGTTACAAAGCCAAAGCAAAAGGTTGAAGATGGTATCTTTGGCACTTCTGGAGGATTTGGTTTTACTAAGCAGAACGAGCTCTTTGTGGGTCGTGTTGCTATGCTTGGTTTTGCAGCATCACTGTTGGGTGAAGGAATAACTGGGAAAGGAATTCTAGCACAATTGAATCTGGAAACTGGAATTCCCCTTTATGAAGCGGAGCCTCTTCTTCTGTTTTTCATCCTCTTCACCCTGCTAGGAGCCATTGGAGGTTTAGGTGACCGTGGAAAATTTGTTGATGACGAACCTACTACTGGAGGTGTTATTCCTCCAGGCAAAGGCTTCAGGGAAGCTCTTGGTCTTGGTTCAGGTCCTTTATTTGGATTCACGAAAGCAAACGAGCTATTTGTGGGAAGATTGGCTCAATTGGGTTTCGTTTTCTCATTGATTGGAGAAATTATAACCGGAAAGGGAGCACTAGCCCAACTCAACATTGAGACTGGGGTACCAATCAACGAAATCGAGCCCCTAGTGTTGTTCAATGTTCTTTTCTTCTTCATTGCTGCTTTGAATCCTGGAACTGGCAAATTCGTTACAGATGAGGGGGAGGATGATTAG

>Glyma04g42870.1   sequence type=predicted peptide   gene model=Glyma04g42870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQTMLLMSSVSSSYSVDLKKDLFLQLQSQSLRPKFSQLSFNPLPSSTSSFSSPRTFTTLALFKSKTKAAPAKTKVTKPKQKVEDGIFGTSGGFGFTKQNELFVGRVAMLGFAASLLGEGITGKGILAQLNLETGIPLYEAEPLLLFFILFTLLGAIGGLGDRGKFVDDEPTTGGVIPPGKGFREALGLGSGPLFGFTKANELFVGRLAQLGFVFSLIGEIITGKGALAQLNIETGVPINEIEPLVLFNVLFFFIAALNPGTGKFVTDEGEDD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo