Glyma04g42800 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g42800

Feature Type:	gene_model
Chromosome:	Gm04
Start:	48457340
stop:	48460668
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g42800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01720	AT	Annotation by Michelle Graham. TAIR10: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein \| chr1:268471-269514 FORWARD LENGTH=289	SoyBase	E_val: 9.00E-144	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0007275	GO-bp	Annotation by Michelle Graham. GO Biological Process: multicellular organismal development	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009620	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fungus	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0009788	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of abscisic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF02365	PFAM	No apical meristem (NAM) protein	JGI		ISS
UniRef100_B2ZGQ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAC domain protein n=2 Tax=Glycine max RepID=B2ZGQ4_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_B2ZGQ4	UniRef	Annotation by Michelle Graham. Best UniRef hit: NAC domain protein n=2 Tax=Glycine max RepID=B2ZGQ4_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma04g42800

Locus	Gene Symbol	Protein Name
	NAC022	NAC Transcription Factor gene 22

Expression Patterns of Glyma04g42800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g42800

Paralog	Evidence	Comments
Glyma06g11970	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g42800 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g249000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g42800

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g42800

Limit To All Plant Sequences

>Glyma04g42800.1   sequence type=CDS   gene model=Glyma04g42800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCGGAGCTTCAATTGCCCCCAGGCTTCAGATTCCATCCAACGGACCAGGAGCTGGTGTTGCACTATCTCTGCCGTAAATGCGCATCGCAGCCTATCGCCGTTCCCATCATCGCCGAAATCGACCTCTACAAATACGACCCCTGGGACCTACCCGGATTGGCTTCCTACGGAGAGAAAGAGTGGTACTTCTTTTCACCACGGGACCGGAAATACCCGAACGGTTCCAGGCCGAACCGGGCGGCGGGAACCGGTTACTGGAAGGCAACCGGGGCGGATAAGCCCATTGGCCACCCCAAACCGGTTGGGATAAAAAAAGCTTTGGTGTTTTACGCAGGGAAAGCTCCGAAAGGGGACAAGAGCAATTGGATCATGCACGAGTATCGTCTCGCCGATGTAGATCGCTCCGTTCGCAAAAAGAACAGCCTAAGGTTAGATGATTGGGTGCTTTGCCGTATTTACAACAAGAAGGGCACGATCGAGAAGTTCCAACCAAGCAGCGATGTTGTTGTTAGCCGAAAAATGGAATCATCGGAGATCGAAGACAGGAAGCCGGAGATTCTGAAAAGCGGAGGAGGTTGTCTTCTGCCGCCGGTTCCGCCGCCGCAAGCGAAGGCGGCGGTGAAGAAGGATTACATGTACTTCGACCCGTCGGATTCAATCCCGAAGCTGCACACGGACTCGAGCTGTTCGGAGCACGTGGTATCGCCGGAATTCGCGAGCGAGGTGCAGAGCGAGCCAAAGTGGAAGGAGTGGGAGAAAAGCCTCGAGTTTCCGTTTAATTACGTGGATGCCACTCTGAACAACAGCAACAGCTTCACGACGCAATTCCAGGGCAATAATCAGATGATGTCGCCGCTGCAGGACATGTTCATGTACTGGCCCAACAAGCCCTTCTGA

Predicted protein sequences of Glyma04g42800

Limit To All Plant Sequences

>Glyma04g42800.1   sequence type=predicted peptide   gene model=Glyma04g42800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASELQLPPGFRFHPTDQELVLHYLCRKCASQPIAVPIIAEIDLYKYDPWDLPGLASYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGHPKPVGIKKALVFYAGKAPKGDKSNWIMHEYRLADVDRSVRKKNSLRLDDWVLCRIYNKKGTIEKFQPSSDVVVSRKMESSEIEDRKPEILKSGGGCLLPPVPPPQAKAAVKKDYMYFDPSDSIPKLHTDSSCSEHVVSPEFASEVQSEPKWKEWEKSLEFPFNYVDATLNNSNSFTTQFQGNNQMMSPLQDMFMYWPNKPF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain