SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g42630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g42630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g42630

Feature Type:gene_model
Chromosome:Gm04
Start:48324611
stop:48326616
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G21780AT Annotation by Michelle Graham. TAIR10: BTB/POZ domain-containing protein | chr1:7652476-7653866 FORWARD LENGTH=326 SoyBaseE_val: 1.00E-62ISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006891GO-bp Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009954GO-bp Annotation by Michelle Graham. GO Biological Process: proximal/distal pattern formation SoyBaseN/AISS
GO:0010227GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ abscission SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0031463GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Cul3-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR24413Panther FAMILY NOT NAMED JGI ISS
PTHR24413:SF216Panther JGI ISS
PF00651PFAM BTB/POZ domain JGI ISS
UniRef100_G7J501UniRef Annotation by Michelle Graham. Most informative UniRef hit: TD and POZ domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J501_MEDTR SoyBaseE_val: 1.00E-75ISS
UniRef100_I1JZ37UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JZ37_SOYBN SoyBaseE_val: 2.00E-127ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g42630 not represented in the dataset

Glyma04g42630 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g12140 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g42630.1   sequence type=CDS   gene model=Glyma04g42630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGATAGGGTGGAGACGCTTGCCAGATTAGCCCAGTGGAAAATCGACAACTTTGGACCTTGTTCCTACAAAAAATCTGACCCCTTCAAGCTCGGAATCTGGAACTGGTGCGTACTAAGTGTTTGTGTTTGTGTATTTGAAATGAATGATCTTCACTTTGAACCTGATCAGGTACTTTTCAACATTCAAGAAAAGCTGCTTAGGACACATGATGACTTTGTCTGGCCTGTGGATACGACTTTTGTTGGTCGCCTCATCATTGATGTTGAGTTTCTAGACCTGAAGATATGCCCTCCGAATGGTGGAGAAACTAGTTCTGTATGGCCTTCTGATGGAAATTCTCAATCCATTGCATTTCAAAATAGCACTCTTCGTTGCCTCTCTCGTATGCTTGATGAGGCTATACACGCTGACTTAACCATCATGACTGCTGATGGCAGCACATTGAGAGCTCATAAGGCAGTTCTCTCAGCTAGTTCTCCAGTGTTCCAGAGCATGTATCATCTCAACCTGAAGGAAAAATAG

>Glyma04g42630.1   sequence type=predicted peptide   gene model=Glyma04g42630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGDRVETLARLAQWKIDNFGPCSYKKSDPFKLGIWNWCVLSVCVCVFEMNDLHFEPDQVLFNIQEKLLRTHDDFVWPVDTTFVGRLIIDVEFLDLKICPPNGGETSSVWPSDGNSQSIAFQNSTLRCLSRMLDEAIHADLTIMTADGSTLRAHKAVLSASSPVFQSMYHLNLKEK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo