Glyma04g42625 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g42625): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g42625): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g42625

Feature Type:	gene_model
Chromosome:	Gm04
Start:	48323969
stop:	48326881
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g42625

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G21780	AT	Annotation by Michelle Graham. TAIR10: BTB/POZ domain-containing protein \| chr1:7652476-7653866 FORWARD LENGTH=326	SoyBase	E_val: 5.00E-35	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0006891	GO-bp	Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009954	GO-bp	Annotation by Michelle Graham. GO Biological Process: proximal/distal pattern formation	SoyBase	N/A	ISS
GO:0010227	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ abscission	SoyBase	N/A	ISS
GO:0016558	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix	SoyBase	N/A	ISS
GO:0048439	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower morphogenesis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0031463	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Cul3-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR24413	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24413:SF216	Panther		JGI		ISS
UniRef100_G7J501	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: TD and POZ domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J501_MEDTR	SoyBase	E_val: 9.00E-36	ISS
UniRef100_UPI000233A224	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A224 related cluster n=1 Tax=unknown RepID=UPI000233A224	SoyBase	E_val: 1.00E-51	ISS

Expression Patterns of Glyma04g42625

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g42625 not represented in the dataset	Glyma04g42625 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g42625 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g42625

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g42625

Limit To All Plant Sequences

>Glyma04g42625.1   sequence type=CDS   gene model=Glyma04g42625   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAACAATCAAGCAAGAAGATTTCTGGAAACACCGGCTTGCATTGCTTGGAGCTGCAAATAAATGACATTGGAAGTCTCAAAGACATCTGTGAGGAAAGCCTTCTGGAAGATCTCAGCACAAGAAATGTTCTTGAGAAGCTAAATGAGGCTTGGCTTTATCAATTGCATAAGTTAAAGAAAGGATGTTTGGTGTTCTTATTTCAATTTGGTAAGATACATGATATTAAAGATGAAATAAATAATTTTTTCCAGCATGCAGATAAGGAGCTAATGCTGGAGATGTTTCAGGAGGTGCCTTCAATTTCAAACCCGGTATAG

Predicted protein sequences of Glyma04g42625

Limit To All Plant Sequences

>Glyma04g42625.1   sequence type=predicted peptide   gene model=Glyma04g42625   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEQSSKKISGNTGLHCLELQINDIGSLKDICEESLLEDLSTRNVLEKLNEAWLYQLHKLKKGCLVFLFQFGKIHDIKDEINNFFQHADKELMLEMFQEVPSISNPV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain