Report for Sequence Feature Glyma04g41150
Feature Type: gene_model
Chromosome: Gm04
Start: 47009932
stop: 47017045
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g41150
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G21320 AT
Annotation by Michelle Graham. TAIR10: nucleotide binding;nucleic acid binding | chr1:7462834-7466164 REVERSE LENGTH=253
SoyBase E_val: 4.00E-40 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0000166 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleotide binding
SoyBase N/A ISS
GO:0003676 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding
SoyBase N/A ISS
PTHR24011 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24011:SF180 Panther
JGI ISS
PF00076 PFAM
RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
JGI ISS
UniRef100_G7J7H8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: RNA-binding protein with multiple splicing n=1 Tax=Medicago truncatula RepID=G7J7H8_MEDTR
SoyBase E_val: 9.00E-109 ISS
UniRef100_I1JYN5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JYN5_SOYBN
SoyBase E_val: 3.00E-141 ISS
Expression Patterns of Glyma04g41150
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma04g41150
Paralog Evidence Comments
Glyma06g13690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g41150 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g233100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g41150
Coding sequences of Glyma04g41150
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g41150.5 sequence type=CDS gene model=Glyma04g41150 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTGACGCTTATTGGAGATACGCCGCCGAATCCCGGCAGGCCCCCTCTTCCATCGCCGGCAAGCGCTCTCGTTCCGACTACGATGTTTCTGGCGTTCACGACTTGCCCGGTTACTTTCCCCATGACGATGATAGAGGAGGGCTCCGAGTAATTAGAGATACTGAATCCCTTGATGCATCTTATGAGCGTTACCTCCGTAGTGCGCAAGTTTCATCATATGGTTCGGGACAGTCTACTAGAACCATTAGTGGGAGAATTCCCAATCGTGCTATTGATGATTCACATGTTGCAAATATTGGGGGAATAGACAGAGGAACAAATGCAAAAGACAAAATGCTGGGATTAAGTAGTGGAAGGACTGACCATTCTCTTCCACCTGATGCTACCAGTACACTGTTTGTGGAGGGCTTGCCTCCCAACTGTACAAGACGGGAAGTAGCTCATATTTTTCGACCTTTTGTTGGCTACAAAGAAGTCAGACTTGTTAGCAAGGAATCGAGACAACCTGGGGGTGATCCACTAGTACTTTGTTTTGTCGATTTTTTGAGTCCTGCTCATGCAGCAACTGCCATGGAAGCATTGCAGGGAAATTGGCATTTGGCAGTTAGTTGCAAGTCATTCATGTTGAGCCACGTTTACCTGTTAGTAACAAGTTGCAGTTCCATAGTTTACACAACAAGAACATGCAATTGGTTGGTTAGTTGGTTATGGGTTATGCATAGCAAGAATAGGCATATGCATGATATTTGCTTGGAACAGCAACGAATGAGCGATATTTTATATTTCTTAGAGTGTGAATATTACTTACAATTATCATGTGCTCTATGA
Predicted protein sequences of Glyma04g41150
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g41150.5 sequence type=predicted peptide gene model=Glyma04g41150 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSDAYWRYAAESRQAPSSIAGKRSRSDYDVSGVHDLPGYFPHDDDRGGLRVIRDTESLDASYERYLRSAQVSSYGSGQSTRTISGRIPNRAIDDSHVANIGGIDRGTNAKDKMLGLSSGRTDHSLPPDATSTLFVEGLPPNCTRREVAHIFRPFVGYKEVRLVSKESRQPGGDPLVLCFVDFLSPAHAATAMEALQGNWHLAVSCKSFMLSHVYLLVTSCSSIVYTTRTCNWLVSWLWVMHSKNRHMHDICLEQQRMSDILYFLECEYYLQLSCAL*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
