SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g40960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g40960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g40960

Feature Type:gene_model
Chromosome:Gm04
Start:46867811
stop:46869881
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46680AT Annotation by Michelle Graham. TAIR10: homeobox 7 | chr2:19165777-19166773 REVERSE LENGTH=258 SoyBaseE_val: 8.00E-47ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000976GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region sequence-specific DNA binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG0484 KOG Transcription factor PHOX2/ARIX, contains HOX domain JGI ISS
PTHR24326Panther FAMILY NOT NAMED JGI ISS
PTHR24326:SF218Panther JGI ISS
PF00046PFAM Homeobox domain JGI ISS
PF02183PFAM Homeobox associated leucine zipper JGI ISS
UniRef100_G7J874UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox-leucine zipper protein ATHB-7 n=1 Tax=Medicago truncatula RepID=G7J874_MEDTR SoyBaseE_val: 1.00E-107ISS
UniRef100_I1JYL0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JYL0_SOYBN SoyBaseE_val: 7.00E-176ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g40960 not represented in the dataset

Glyma04g40960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g13890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g231400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g40960.1   sequence type=CDS   gene model=Glyma04g40960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGAGGGAGATGAGAATATTCAAGCATCATCAAAGGGAAAATATGTTGAAAGCTTCAACTGCTCGGAGGCACCAAGGAAGAAAAGCAAGAAGATAGAAAACAAGAGGAGGTTTAGTGATGAACAGATAAGATCACTAGAATGCATATTTGAGTCAGAGTCAAAGCTTGAGCCAAGGAAGAAGATGCAACTGGCTAGAGATCTTGGCCTGCAGCCTCGCCAAGTGGCTATATGGTTCCAAAACAGAAGGGCAAGGTGGAAATCAAAACGAATAGAGCAAGAGTACCGAAAACTCAAAGATGAATATGACAATTTAGCATCAAGGTTTGAGTCCCTAAAGAAAGAGAAGGACTCTTTGCAATTAGAGTTGCAGAAACTAAGTGATTTGTTGGAGGCATGTCAAGATGATGGAAGGGAAGACAAGGCTGGCAAAGAAAACAGCATAGAAGATGGTGGCTCAGGCAGTGGATACAGCAGTTGGAAGCCTGAAGCAAAACCAAGGTTTTCAAATGAGGGTTTGGAGGAGAGAATAGGTGTGTACTCAGATGATCAAAATGAGAATAGCATCATAAGGGGTGGTGAGAAATCTGAAGACAAAGGACACCAACTTCTCAGAATGGATGATCATGCAGAGATGCCATTGGCATCACTTGAAAAATGGTATAGTGGTGTGGACCCTAGTGGCATCTTGGACCAGTCATGTAGCAGTTCTCAATGGCTAGATTTCTGGACTTGA

>Glyma04g40960.1   sequence type=predicted peptide   gene model=Glyma04g40960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMEGDENIQASSKGKYVESFNCSEAPRKKSKKIENKRRFSDEQIRSLECIFESESKLEPRKKMQLARDLGLQPRQVAIWFQNRRARWKSKRIEQEYRKLKDEYDNLASRFESLKKEKDSLQLELQKLSDLLEACQDDGREDKAGKENSIEDGGSGSGYSSWKPEAKPRFSNEGLEERIGVYSDDQNENSIIRGGEKSEDKGHQLLRMDDHAEMPLASLEKWYSGVDPSGILDQSCSSSQWLDFWT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo