Glyma04g40930 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g40930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g40930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g40930

Feature Type:	gene_model
Chromosome:	Gm04
Start:	46841451
stop:	46841846
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g40930

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G46690	AT	Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family \| chr2:19180904-19181269 FORWARD LENGTH=121	SoyBase	E_val: 6.00E-42	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02519	PFAM	Auxin responsive protein	JGI		ISS
UniRef100_G7J880	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin-induced protein 10A5 n=1 Tax=Medicago truncatula RepID=G7J880_MEDTR	SoyBase	E_val: 2.00E-51	ISS
UniRef100_UPI000189D169	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000189D169 related cluster n=1 Tax=unknown RepID=UPI000189D169	SoyBase	E_val: 6.00E-88	ISS

Expression Patterns of Glyma04g40930

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g40930 not represented in the dataset	Glyma04g40930 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g40930

Paralog	Evidence	Comments
Glyma06g13910	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g40930 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g231100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g40930

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g40930

Limit To All Plant Sequences

>Glyma04g40930.1   sequence type=CDS   gene model=Glyma04g40930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGATCCTTAGCGATCATCATAATCAGAAGCATCACCACCACCACCATCATCTCATGAGTTTTCATTTGCACATTCCTCACCTTCAGTACTTTCACCATCACCAACAACAAGAGAAGAAGGAGGATCTGAAGGACATTCCAAAAGGGTGTTTGGCCATCTTGGTAGGGCAAGGGGAGGAGCAACAGAGGTTTGTGATCCCTGTGATGTACATGAACCACCCATTGTTCATGCAGTTGCTGAAAAAAGCTGAAGAGGAATACGGGTTCGACCAGAAAGGCCCCATCACCATTCCTTGCCACGTGGAGCACTTCCGCTCTGTTCAAGGCTTGATTGATAAGGACAAATCCCTCCACCATGGCCATCACCACCATGCTTGGTGCTTCAAAGTTTGA

Predicted protein sequences of Glyma04g40930

Limit To All Plant Sequences

>Glyma04g40930.1   sequence type=predicted peptide   gene model=Glyma04g40930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGILSDHHNQKHHHHHHHLMSFHLHIPHLQYFHHHQQQEKKEDLKDIPKGCLAILVGQGEEQQRFVIPVMYMNHPLFMQLLKKAEEEYGFDQKGPITIPCHVEHFRSVQGLIDKDKSLHHGHHHHAWCFKV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain