SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g40780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g40780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g40780

Feature Type:gene_model
Chromosome:Gm04
Start:46742555
stop:46743771
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g40780
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03890AT Annotation by Michelle Graham. TAIR10: unknown protein; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G10120.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:1047150-1047689 FORWARD LENGTH=179 SoyBaseE_val: 4.00E-12ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
UniRef100_C6T587UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T587_SOYBN SoyBaseE_val: 8.00E-101ISS
UniRef100_Q9LZC0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Emb|CAB85509.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LZC0_ARATH SoyBaseE_val: 2.00E-09ISS

Expression Patterns of Glyma04g40780
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g40780 not represented in the dataset
Glyma04g40780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g40780
ParalogEvidenceComments
Glyma06g14010 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g40780 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g229700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g40780
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g40780
>Glyma04g40780.1   sequence type=CDS   gene model=Glyma04g40780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAATTGTCTTGATCTTTGTAAACCCAGTTCAGGGTCTTGCATAGCAAAAAAGGTTAAACTTGTGAGGGTAGCCAAACCAGATGGTAAGATACTAGAGTTCAGCACCCCGATCCATGTCAAAGATATCTTGACAAGTTATCCAGCTTATGGTGTTGGTGTTTCAAAGAAAGTCACAGAACATCTCTCCCCAGATCATGAATTGAAGGCAGGGAGATTGTACTACTTGCTTCCCTCTTTGCATTCCCCTCCAAATCTTAAATCTTTAAAGACAGGTGGAGGGATAAAGAGGATCAAAGTTATAATAACGAAGCAGCAGCTGCAGCAGTTAGTGACCAAACAGATCTCAGTAGAGGATATACTATCGGAGGTTCAAACGGTTGGTGTTAAGTTTTCAAGCAATCAGAAGACAAAATTGGACTCTATACCCGAAGAAGATGAGTAA
Predicted protein sequences of Glyma04g40780
>Glyma04g40780.1   sequence type=predicted peptide   gene model=Glyma04g40780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNCLDLCKPSSGSCIAKKVKLVRVAKPDGKILEFSTPIHVKDILTSYPAYGVGVSKKVTEHLSPDHELKAGRLYYLLPSLHSPPNLKSLKTGGGIKRIKVIITKQQLQQLVTKQISVEDILSEVQTVGVKFSSNQKTKLDSIPEEDE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo