SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g40720

Feature Type:gene_model
Chromosome:Gm04
Start:46675344
stop:46677019
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g40720
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24510AT Annotation by Michelle Graham. TAIR10: 60S acidic ribosomal protein family | chr5:8369295-8369866 REVERSE LENGTH=111 SoyBaseE_val: 2.00E-32ISS
GO:0006414GO-bp Annotation by Michelle Graham. GO Biological Process: translational elongation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG1762 KOG 60s acidic ribosomal protein P1 JGI ISS
PTHR21141Panther 60S ACIDIC RIBOSOMAL PROTEIN FAMILY MEMBER JGI ISS
PF00428PFAM 60s Acidic ribosomal protein JGI ISS
UniRef100_G7J8Y6UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S acidic ribosomal protein P1 n=1 Tax=Medicago truncatula RepID=G7J8Y6_MEDTR SoyBaseE_val: 2.00E-28ISS
UniRef100_I1JYI8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JYI8_SOYBN SoyBaseE_val: 5.00E-70ISS

Expression Patterns of Glyma04g40720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g40720
ParalogEvidenceComments
Glyma06g14080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g40720 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g229000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g40720
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g40720
>Glyma04g40720.1   sequence type=CDS   gene model=Glyma04g40720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCCGGTGTCCAAGGTTGCATCTTAGCCACTTTAATTCTCCACGACGAGGAAATCCCAGTCACCGCTGAGAAGATCAACGCTCTGTTGAAGGCTTCTAATGTCTCCGCCGAGTCTTACTGGCCCAGCCTCTTCGCCAAGCTCGCCCAGAATAAGAACATCGAAGACCTCATTTTGAACGCCGGCGGTGGTGGGGCCGCCGTTGCAGTTGCCGCTCCCGCCGGCGGTGGTGGTGGTGCCGCTGCTGCAGCCGCACCCGCCGCCGAGGAAAAGAAGGAAGAAGTGAAGGAAGAAAGTGACGATGACATGGGTTTCGGCTTGTTTGATTAG
Predicted protein sequences of Glyma04g40720
>Glyma04g40720.1   sequence type=predicted peptide   gene model=Glyma04g40720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSGVQGCILATLILHDEEIPVTAEKINALLKASNVSAESYWPSLFAKLAQNKNIEDLILNAGGGGAAVAVAAPAGGGGGAAAAAAPAAEEKKEEVKEESDDDMGFGLFD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo