SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g40470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g40470): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g40470

Feature Type:gene_model
Chromosome:Gm04
Start:46526991
stop:46528229
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G33140AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L6 family | chr1:12023360-12024502 FORWARD LENGTH=194 SoyBaseE_val: 1.00E-120ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009955GO-bp Annotation by Michelle Graham. GO Biological Process: adaxial/abaxial pattern specification SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022625GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
GO:0019843GO-mf Annotation by Michelle Graham. GO Molecular Function: rRNA binding SoyBaseN/AISS
KOG3255 KOG 60S ribosomal protein L9 JGI ISS
PTHR11655Panther 60S RIBOSOMAL PROTEIN L9 FAMILY MEMBER JGI ISS
PTHR11655:SF2Panther 50S RIBOSOMAL PROTEIN L6 JGI ISS
PF00347PFAM Ribosomal protein L6 JGI ISS
UniRef100_E5GBD5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein l9 n=1 Tax=Cucumis melo subsp. melo RepID=E5GBD5_CUCME SoyBaseE_val: 7.00E-126ISS
UniRef100_I1JYG3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JYG3_SOYBN SoyBaseE_val: 2.00E-136ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g40470 not represented in the dataset

Glyma04g40470 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g14330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g226900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g40470.1   sequence type=CDS   gene model=Glyma04g40470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGACGATTCTTTCCACCGAGACCATGAACATCCCGGACGGCGTGAGCATCAAAGTTCATGCCAAGGTCATCGAAGTTGAGGGCCCCCGCGGAAAATTGGTGCGAGACTTCAAGCATTTGAATCTCGATTTTCAGCTCATTACTGACGAAAACGGTAAAAGAAAGCTGAAAATCGACGCGTGGTTTGGTTCTCGGAAAACATCCGCCGCCATTCGCACCGCCTTGAGCCACGTGGAGAATCTTATCACCGGCGTCACCAAGGGCTACCGCTACAAAATGAGGTTCGTTTATGCCCATTTTCCCATCAACGCAAGCATCGGCAACAGCAACAAGTCTATTGAGATCCGAAATTTCCTTGGCGAGAAGAAGGTGAGGAAAGTCGACATGCTTGATGGCGTGTCCGTTGTTCGATCTGAAAAAGTTAAAGATGAGTTGATTTTGGATGGAAACGACATTGAACTTGTTTCTAGGTCCTGTGCTCTCATTAACCAGAAATGCCATGTTAAAAACAAGGATATCAGGAAATTTCTGGATGGTATTTATGTTAGTGAGAAGGGAACAATACTGGAAGAGTAG

>Glyma04g40470.1   sequence type=predicted peptide   gene model=Glyma04g40470   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTILSTETMNIPDGVSIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLITDENGKRKLKIDAWFGSRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPINASIGNSNKSIEIRNFLGEKKVRKVDMLDGVSVVRSEKVKDELILDGNDIELVSRSCALINQKCHVKNKDIRKFLDGIYVSEKGTILEE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo