SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g39030

Feature Type:gene_model
Chromosome:Gm04
Start:45290953
stop:45301331
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G43890AT Annotation by Michelle Graham. TAIR10: RAB GTPASE HOMOLOG B18 | chr1:16646934-16648395 FORWARD LENGTH=212 SoyBaseE_val: 1.00E-119ISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
KOG0080 KOG GTPase Rab18, small G protein superfamily JGI ISS
PTHR24073Panther FAMILY NOT NAMED JGI ISS
PTHR24073:SF482Panther JGI ISS
PF00071PFAM Ras family JGI ISS
UniRef100_G7JBL5UniRef Annotation by Michelle Graham. Most informative UniRef hit: GTP-binding protein yptV3 n=1 Tax=Medicago truncatula RepID=G7JBL5_MEDTR SoyBaseE_val: 1.00E-133ISS
UniRef100_I1JY15UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JY15_SOYBN SoyBaseE_val: 3.00E-149ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g15950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g212400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g39030.1   sequence type=CDS   gene model=Glyma04g39030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCGAGTTCAACCCAGGAATTCGAATATTTGTTTAAGTTGTTGATGATTGGGGACTCAGGTGTTGGCAAGAGTAGTCTCCTCCTCTGTTTCACATCTGATTCCTTTGAAGATCTTTCTCCCACAATTGGTGTTGATTTTAAAGTCAAGTATTTGACAATGGAAGGTAAAAAGCTGAAGCTTGCCATTTGGGATACAGCTGGTCAAGAGAGATTCAGAACATTGACAAGTTCTTACTACCGAGGTGCTCAAGGGATCATTATGGCTTATGATGTAACTCGGCGGGAAACGTTTACGAATCTCTCTGAAATATGGGCAAAGGAAATAGACCTTTATTCAACAAATCCGGAATGCATCAAGATGCTTGTTGGAAACAAAGTGGATAAGGAGGGTGATAGAGTAGTGACAAAGAAAGAGGGAGTAGACTTTGCCAGGGAATGTGGTTGCCTATTTATTGAATGCAGTGCTAAAACACGAGTTAACGTACAACAATGCTTTGAAGAGCTTGTTCTGAAGATTCTGGATACACCTAGCCTCTTAGCCGAGGGATCCAAGGGCAATAAAAAGAACATTTTTAAGGACAAGCCATCCCAGACTAATGCCACGAGTAGTTGTTGCTGA

>Glyma04g39030.1   sequence type=predicted peptide   gene model=Glyma04g39030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSSSTQEFEYLFKLLMIGDSGVGKSSLLLCFTSDSFEDLSPTIGVDFKVKYLTMEGKKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMAYDVTRRETFTNLSEIWAKEIDLYSTNPECIKMLVGNKVDKEGDRVVTKKEGVDFARECGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGNKKNIFKDKPSQTNATSSCC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo