SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g38461

Feature Type:gene_model
Chromosome:Gm04
Start:44866946
stop:44870141
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g38461
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80500AT Annotation by Michelle Graham. TAIR10: SNARE-like superfamily protein | chr1:30271195-30272431 FORWARD LENGTH=135 SoyBaseE_val: 3.00E-92ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3487 KOG TRAPP 20 K subunit JGI ISS
PTHR12403Panther MBP-1 INTERACTING PROTEIN-2A JGI ISS
PF04628PFAM Sedlin, N-terminal conserved region JGI ISS
UniRef100_C6T399UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T399_SOYBN SoyBaseE_val: 1.00E-94ISS
UniRef100_F4HTY0UniRef Annotation by Michelle Graham. Most informative UniRef hit: SNARE-like protein n=1 Tax=Arabidopsis thaliana RepID=F4HTY0_ARATH SoyBaseE_val: 2.00E-89ISS

Expression Patterns of Glyma04g38461
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g38461 not represented in the dataset
Glyma04g38461 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g38461
ParalogEvidenceComments
Glyma06g16590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g38461 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g207300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g38461
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g38461
>Glyma04g38461.1   sequence type=CDS   gene model=Glyma04g38461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACCACTGCCTGTTTCATCATTGTTAGCAGAAATGACATTCCTATATATGAAGCTGAAGTTGGAGTAGCTGCTAAAAGGGAAGATGCTGCTCAACTGCATCAATTTATCCTTCATGCTGCTCTTGATATTGTTCAGGACCTTGCATGGACTACTAGTGCCATGTACTTGAAATCAGTAGACAGGTTTAATGAACTTGTGGTGTCAGTGTATGTTACAGCTGGTCATACCCGACTTATGTTGCTACATGACTCCCGTAATGATGATGGTATTAAGAGCTTCTTCCAAGAGGTGCATGAGCTTTACATAAAGACTCTCCTTAATCCCCTGTACTTGCCTGGCTCCCGGATCACGTCATCACATTTTGATACTAAAGTCCGAGCCCTTGCACGAAAGTATCTGTAG
Predicted protein sequences of Glyma04g38461
>Glyma04g38461.1   sequence type=predicted peptide   gene model=Glyma04g38461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATTACFIIVSRNDIPIYEAEVGVAAKREDAAQLHQFILHAALDIVQDLAWTTSAMYLKSVDRFNELVVSVYVTAGHTRLMLLHDSRNDDGIKSFFQEVHELYIKTLLNPLYLPGSRITSSHFDTKVRALARKYL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo