SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g38135

Feature Type:gene_model
Chromosome:Gm04
Start:44532144
stop:44534201
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g38135
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04290AT Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein | chr1:1147721-1148352 REVERSE LENGTH=155 SoyBaseE_val: 1.00E-36ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
GO:0047617GO-mf Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity SoyBaseN/AISS
PTHR21660Panther THIOESTERASE SUPERFAMILY MEMBER-RELATED JGI ISS
PF03061PFAM Thioesterase superfamily JGI ISS
UniRef100_G7J2N8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Acyl-coenzyme A thioesterase n=1 Tax=Medicago truncatula RepID=G7J2N8_MEDTR SoyBaseE_val: 3.00E-39ISS
UniRef100_UPI0002339D90UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339D90 related cluster n=1 Tax=unknown RepID=UPI0002339D90 SoyBaseE_val: 1.00E-95ISS

Expression Patterns of Glyma04g38135
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g38135 not represented in the dataset
Glyma04g38135 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g38135 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g204200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g38135
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g38135
>Glyma04g38135.1   sequence type=CDS   gene model=Glyma04g38135   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTTGGAAAGTATAAACAAGTTGTTGGAGGAAGGAGCCCAAAGCGAGAGTCCATCTCATTCTCTCTCCACTTTCTATTATATCTTCATCTTCTTCTTAACTCATGATTTGTCTATTTTTCCATCGAAGAATGGTGGGAATTCGTTGCACGGTGGTGCCACCGCTACGCTGGTGGCTTTAGTCGGCGCAGCCGCGATTCTCTCTGCCGGACATTCATCCGATTCGGGAGTTTCCGTCGAGATCAACGTCTCCTACTTCGGTGCTGTCTACGCTCATGAGGAGATTGAGATAGATGCTCGGGTTCTACGTGTAGGAAAGGCTGTTGCAGTTGTGAGCGTGGAGTTCAGAAAGAAGAAAACTGGCAAAGTTTTTGCTCAGTGGCGTCACACCAAGTATCTTCCCATTACCAGTAAAATCTGA
Predicted protein sequences of Glyma04g38135
>Glyma04g38135.1   sequence type=predicted peptide   gene model=Glyma04g38135   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLESINKLLEEGAQSESPSHSLSTFYYIFIFFLTHDLSIFPSKNGGNSLHGGATATLVALVGAAAILSAGHSSDSGVSVEINVSYFGAVYAHEEIEIDARVLRVGKAVAVVSVEFRKKKTGKVFAQWRHTKYLPITSKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo