Glyma04g38130 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g38130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g38130): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g38130

Feature Type:	gene_model
Chromosome:	Gm04
Start:	44526092
stop:	44532080
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g38130

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G31305	AT	Annotation by Michelle Graham. TAIR10: inhibitor-3 \| chr2:13350909-13351232 FORWARD LENGTH=107	SoyBase	E_val: 5.00E-23	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0032515	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of phosphoprotein phosphatase activity	SoyBase	N/A	ISS
GO:0000164	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: protein phosphatase type 1 complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG4102	KOG	Uncharacterized conserved protein	JGI		ISS
PTHR20835	Panther	HCG V (PROTEIN PHOSPHATASE 1, REGULATORY (INHIBITOR) SUBUNIT)	JGI		ISS
PF07491	PFAM	Protein phosphatase inhibitor	JGI		ISS
UniRef100_A2Q5P6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein phosphatase inhibitor n=1 Tax=Medicago truncatula RepID=A2Q5P6_MEDTR	SoyBase	E_val: 4.00E-45	ISS
UniRef100_C6T5B9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5B9_SOYBN	SoyBase	E_val: 2.00E-83	ISS

Expression Patterns of Glyma04g38130

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g38130 not represented in the dataset	Glyma04g38130 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g38130

Paralog	Evidence	Comments
Glyma06g16930	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g38130 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g204100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g38130

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g38130

Limit To All Plant Sequences

>Glyma04g38130.1   sequence type=CDS   gene model=Glyma04g38130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAGACGCACGAACACCTCCAGGCCAGTGGCATTGTCTTCCCCTTCTATCACTGCCACCACCACCACCACCATAACAATTTTGAACTCTGAGCCATCATCCTCTTCATCCCAGCAGGAACAACAGCAACCAGAAGTCCTCTTCCTCCCACTCAATCGCAAGAAGAAGAAGGTTTCTTGGAAAGAGGGCACTGTAGACAACGAGTTCATGCAGAAAAAGAGTTCCAAGAAGTGCTGTATCTTCCATAAACAAAAGCCCTTTGATGAAGATGATAGTGATGAAGATGAACATCACTCTGATGAACACCCTCACGATAGTGGGTTTTGCTGTAAGAATTATGATGAAGCTGGCCCAAGCAGTTAG

Predicted protein sequences of Glyma04g38130

Limit To All Plant Sequences

>Glyma04g38130.1   sequence type=predicted peptide   gene model=Glyma04g38130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDRRTNTSRPVALSSPSITATTTTTITILNSEPSSSSSQQEQQQPEVLFLPLNRKKKKVSWKEGTVDNEFMQKKSSKKCCIFHKQKPFDEDDSDEDEHHSDEHPHDSGFCCKNYDEAGPSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain