Report for Sequence Feature Glyma04g38020
Feature Type: gene_model
Chromosome: Gm04
Start: 44450092
stop: 44452801
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma04g38020
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G59880 AT
Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G44010.1); Has 20 Blast hits to 20 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 20; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:22121069-22121446 FORWARD LENGTH=125
SoyBase E_val: 3.00E-12 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1JXS9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JXS9_SOYBN
SoyBase E_val: 2.00E-81 ISS
UniRef100_Q5BPM7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q5BPM7_ARATH
SoyBase E_val: 2.00E-09 ISS
Expression Patterns of Glyma04g38020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma04g38020
Paralog Evidence Comments
Glyma06g17040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma04g38020 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.04g203100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma04g38020
Coding sequences of Glyma04g38020
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma04g38020.1 sequence type=CDS gene model=Glyma04g38020 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGGTCTTCTGCCTCTTGTTTACAAAGCAATCAAGAGAAACAAAACACGACGGCAATATGAGTGTCTTTCATCAGGAACCTCTCTAGGGTACAACATCAGCATGCCCGAGATGTACCCTCAAACTCAGGACCATGTCCTTCAGAATCAGACACATACCCAGAAAATGTTTCACCACCCTGAAGAAGGTCACAAAGTTGGTCACAGGAGATATAACTCTGTTGATGATCATTTCAATTATGGGTTCCAATCTGCTCAGATGAGAACAGGCGTTGATGCTCCCTCTTCGAACAAACTTGTAAGGTTTAGGAGCCAGAGAATGTTTTCATGTATCACTGGTGTTTAA
Predicted protein sequences of Glyma04g38020
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma04g38020.1 sequence type=predicted peptide gene model=Glyma04g38020 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEGLLPLVYKAIKRNKTRRQYECLSSGTSLGYNISMPEMYPQTQDHVLQNQTHTQKMFHHPEEGHKVGHRRYNSVDDHFNYGFQSAQMRTGVDAPSSNKLVRFRSQRMFSCITGV*