SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g38020

Feature Type:gene_model
Chromosome:Gm04
Start:44450092
stop:44452801
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g38020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G59880AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G44010.1); Has 20 Blast hits to 20 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 20; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:22121069-22121446 FORWARD LENGTH=125 SoyBaseE_val: 3.00E-12ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JXS9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JXS9_SOYBN SoyBaseE_val: 2.00E-81ISS
UniRef100_Q5BPM7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q5BPM7_ARATH SoyBaseE_val: 2.00E-09ISS

Expression Patterns of Glyma04g38020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g38020
ParalogEvidenceComments
Glyma06g17040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g38020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g203100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g38020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g38020
>Glyma04g38020.1   sequence type=CDS   gene model=Glyma04g38020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTCTTCTGCCTCTTGTTTACAAAGCAATCAAGAGAAACAAAACACGACGGCAATATGAGTGTCTTTCATCAGGAACCTCTCTAGGGTACAACATCAGCATGCCCGAGATGTACCCTCAAACTCAGGACCATGTCCTTCAGAATCAGACACATACCCAGAAAATGTTTCACCACCCTGAAGAAGGTCACAAAGTTGGTCACAGGAGATATAACTCTGTTGATGATCATTTCAATTATGGGTTCCAATCTGCTCAGATGAGAACAGGCGTTGATGCTCCCTCTTCGAACAAACTTGTAAGGTTTAGGAGCCAGAGAATGTTTTCATGTATCACTGGTGTTTAA
Predicted protein sequences of Glyma04g38020
>Glyma04g38020.1   sequence type=predicted peptide   gene model=Glyma04g38020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGLLPLVYKAIKRNKTRRQYECLSSGTSLGYNISMPEMYPQTQDHVLQNQTHTQKMFHHPEEGHKVGHRRYNSVDDHFNYGFQSAQMRTGVDAPSSNKLVRFRSQRMFSCITGV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo