SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g37950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g37950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g37950

Feature Type:gene_model
Chromosome:Gm04
Start:44386921
stop:44391148
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G51020AT Annotation by Michelle Graham. TAIR10: crumpled leaf | chr5:20745560-20747165 REVERSE LENGTH=269 SoyBaseE_val: 3.00E-155ISS
GO:0000302GO-bp Annotation by Michelle Graham. GO Biological Process: response to reactive oxygen species SoyBaseN/AISS
GO:0010020GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast fission SoyBaseN/AISS
GO:0017009GO-bp Annotation by Michelle Graham. GO Biological Process: protein-phycocyanobilin linkage SoyBaseN/AISS
GO:0043572GO-bp Annotation by Michelle Graham. GO Biological Process: plastid fission SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009707GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast outer membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06206PFAM CpeT/CpcT family (DUF1001) JGI ISS
UniRef100_E6NU06UniRef Annotation by Michelle Graham. Most informative UniRef hit: JHL07K02.6 protein n=1 Tax=Jatropha curcas RepID=E6NU06_9ROSI SoyBaseE_val: 1.00E-168ISS
UniRef100_I1JXS0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JXS0_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g37950 not represented in the dataset

Glyma04g37950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g17120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g202400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g37950.1   sequence type=CDS   gene model=Glyma04g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTACCGGGGATTCGGATTCGGAATCGAATGGATGGAACCGTGCTCGTGGGTTGGCGCTTAAGACTCTGCTACTAATTGGTGGCGCACTTCTCGTTAAGCGCCTCCGCAAGTCCACCACGCGTTGGGACCACGCTCATTTCGTCTCCAACTCCCTCACCGGCGAAAAGTATTCCAAGGAGCAAGCTTCCAGAGACCCGGATAACTATTTCAACATTAGAATGCTTACATGCCCCGCAGCGGAGCTAGTGGATGGTTCCAAGGTCTTGTATTTTGAACAGGCTTTTTGGAGGACTCCACAAAAACCCTTTCGGCAGAGGCTTTTTATGGTGAAACCTTGTCCTAAAGAGTTGAAATGTGATGTTGAGTTAAGTACATATGCCATTAGAGACATGGAGGAGTACAAAAATTTCTGTGATCGACCAAGGGATCAGCGTCCACAGCCGGAAGAAGTCATTGGAGATATTGCTGAACATTTGACAACAGTACATCTTAAGCGTTGTCCACGTGGAAAACGTTGCTTATATGAAGGTTCAACCCCACCTGGTGGATTTCCTAATTCATGGAATGGGGCAACCTACTGTACTTCAGAGCTTGCGATTTTAAAGAACAATGAGATACATACCTGGGACAGGGGTTATGATGATGGTGGAAATCAAGTTTGGGGGCAAAAAGAAGGCCCTTACGAGTTCAAGCCTGCACCAACCTCCAGTTTTAATGATATGTTTTCTCCTTTGAATTTCCCCCCTCCACCATCCATGGAGAGAAGAATAGAGGGTTCATTTGTTTTGCAAGAATGA

>Glyma04g37950.1   sequence type=predicted peptide   gene model=Glyma04g37950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTGDSDSESNGWNRARGLALKTLLLIGGALLVKRLRKSTTRWDHAHFVSNSLTGEKYSKEQASRDPDNYFNIRMLTCPAAELVDGSKVLYFEQAFWRTPQKPFRQRLFMVKPCPKELKCDVELSTYAIRDMEEYKNFCDRPRDQRPQPEEVIGDIAEHLTTVHLKRCPRGKRCLYEGSTPPGGFPNSWNGATYCTSELAILKNNEIHTWDRGYDDGGNQVWGQKEGPYEFKPAPTSSFNDMFSPLNFPPPPSMERRIEGSFVLQE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo