Glyma04g37291 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g37291

Feature Type:	gene_model
Chromosome:	Gm04
Start:	43660032
stop:	43660700
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g37291

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G48590	AT	Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit C1 \| chr3:18008893-18009938 REVERSE LENGTH=234	SoyBase	E_val: 2.00E-101	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016602	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CCAAT-binding factor complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG1657	KOG	CCAAT-binding factor, subunit C (HAP5)	JGI		ISS
PTHR10252	Panther	HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED	JGI		ISS
PTHR10252:SF6	Panther	CCAAT-BINDING TRANSCRIPTION FACTOR	JGI		ISS
PF00808	PFAM	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	JGI		ISS
UniRef100_G7J3W1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit C-1 n=1 Tax=Medicago truncatula RepID=G7J3W1_MEDTR	SoyBase	E_val: 7.00E-102	ISS
UniRef100_I1JXK3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JXK3_SOYBN	SoyBase	E_val: 1.00E-160	ISS

Expression Patterns of Glyma04g37291

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g37291 not represented in the dataset	Glyma04g37291 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g37291

Paralog	Evidence	Comments
Glyma06g17780	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g37291 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g196200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g37291

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g37291

Limit To All Plant Sequences

>Glyma04g37291.1   sequence type=CDS   gene model=Glyma04g37291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAACAACCAGCAACAAGGCGCTCAAGCCCAATCGGGACCGTACCCCGGCGGCGCCGGTGGAAGTGCAGGTGCAGGTGCAGGTGCAGGCGCGGCCCCGTTCCAGCACCTGCTCCAGCAGCAGCAGCAGCAGCTGCAGATGTTCTGGTCGTACCAGCGGCAAGAGATCGAGCACGTGAACGACTTCAAGAACCACCAGCTCCCCTTGGCCCGCATCAAGAAGATCATGAAGGCCGACGAGGACGTCCGCATGATCTCCGCCGAGGCCCCCATCCTCTTCGCCAAGGCCTGCGAGCTCTTCATCCTCGAGCTCACCATCCGCTCCTGGCTCCACGCCGACGAGAACAAGCGCCGCACCCTCCAGAAGAACGACATCGCCGCCGCCATCACTCGCACCGACATTTTCGACTTCCTCGTCGACATCGTCCCCCGCGACGAGATCAAGGACGACGCCGCGCTCGTCGGGGCAACGGCCAGTGGGGTGCCTTACTACTACCCGCCCATTGGCCAGCCTGCCGGGATGATGATTGGCCGCCCCGCCGTCGATCCCGCCACCGGAGTTTATGTCCAGCCGCCCTCCCAGGCCTGGCAGTCCGTCTGGCAGTCCGCCGCCGAGGACACGCCCTACGGCACCGGTGCCCAGGGGAACCTTGATGGCCAGAGGTAA

Predicted protein sequences of Glyma04g37291

Limit To All Plant Sequences

>Glyma04g37291.1   sequence type=predicted peptide   gene model=Glyma04g37291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MENNQQQGAQAQSGPYPGGAGGSAGAGAGAGAAPFQHLLQQQQQQLQMFWSYQRQEIEHVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHADENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDDAALVGATASGVPYYYPPIGQPAGMMIGRPAVDPATGVYVQPPSQAWQSVWQSAAEDTPYGTGAQGNLDGQR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain