| 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT1G50840 | AT | Annotation by Michelle Graham. TAIR10: polymerase gamma 2 | chr1:18839277-18844313 FORWARD LENGTH=1050 | SoyBase | E_val: 2.00E-13 | ISS | 
| GO:0006139 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process | SoyBase | N/A | ISS | 
| GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS | 
| GO:0006264 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mitochondrial DNA replication | SoyBase | N/A | ISS | 
| GO:0033259 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plastid DNA replication | SoyBase | N/A | ISS | 
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS | 
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS | 
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS | 
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS | 
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS | 
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS | 
| GO:0003887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA-directed DNA polymerase activity | SoyBase | N/A | ISS | 
| GO:0008408 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 3'-5' exonuclease activity | SoyBase | N/A | ISS | 
| UniRef100_G7J1V6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: DNA polymerase n=1 Tax=Medicago truncatula RepID=G7J1V6_MEDTR | SoyBase | E_val: 1.00E-12 | ISS | 
| UniRef100_G7J1V6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase n=1 Tax=Medicago truncatula RepID=G7J1V6_MEDTR | SoyBase | E_val: 1.00E-12 | ISS | 
| 
			 Glyma04g37010 not represented in the dataset  | 
			 Glyma04g37010 not represented in the dataset  | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection  | 
			Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome  | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183  | 
    
>Glyma04g37010.1 sequence type=CDS gene model=Glyma04g37010 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GGGCATAATATATCAGGAAAGGATCACCGTGTTCATTGTTCCATAAATATCAACACAGAGACTGGACGTTTGTCAGCAAGAAGGCCAAATCTGCAGGTGATCATGTGTTCTTCCCGCTCTCTTAAAACAAGTGTCCTGATCTTGAAATCATACGCCATCTTGAAAGACGCCATCTTGAAAGATCATACGTGA
>Glyma04g37010.1 sequence type=predicted peptide gene model=Glyma04g37010 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GHNISGKDHRVHCSININTETGRLSARRPNLQVIMCSSRSLKTSVLILKSYAILKDAILKDHT*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||