Glyma04g37010 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g37010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g37010): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g37010

Feature Type:	gene_model
Chromosome:	Gm04
Start:	43484555
stop:	43486190
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g37010

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G50840	AT	Annotation by Michelle Graham. TAIR10: polymerase gamma 2 \| chr1:18839277-18844313 FORWARD LENGTH=1050	SoyBase	E_val: 2.00E-13	ISS
GO:0006139	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process	SoyBase	N/A	ISS
GO:0006260	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication	SoyBase	N/A	ISS
GO:0006264	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial DNA replication	SoyBase	N/A	ISS
GO:0033259	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid DNA replication	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed DNA polymerase activity	SoyBase	N/A	ISS
GO:0008408	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 3'-5' exonuclease activity	SoyBase	N/A	ISS
UniRef100_G7J1V6	UniRef	Annotation by Michelle Graham. Best UniRef hit: DNA polymerase n=1 Tax=Medicago truncatula RepID=G7J1V6_MEDTR	SoyBase	E_val: 1.00E-12	ISS
UniRef100_G7J1V6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase n=1 Tax=Medicago truncatula RepID=G7J1V6_MEDTR	SoyBase	E_val: 1.00E-12	ISS

Expression Patterns of Glyma04g37010

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g37010 not represented in the dataset	Glyma04g37010 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g37010 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g37010

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g37010

Limit To All Plant Sequences

>Glyma04g37010.1   sequence type=CDS   gene model=Glyma04g37010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGGCATAATATATCAGGAAAGGATCACCGTGTTCATTGTTCCATAAATATCAACACAGAGACTGGACGTTTGTCAGCAAGAAGGCCAAATCTGCAGGTGATCATGTGTTCTTCCCGCTCTCTTAAAACAAGTGTCCTGATCTTGAAATCATACGCCATCTTGAAAGACGCCATCTTGAAAGATCATACGTGA

Predicted protein sequences of Glyma04g37010

Limit To All Plant Sequences

>Glyma04g37010.1   sequence type=predicted peptide   gene model=Glyma04g37010   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GHNISGKDHRVHCSININTETGRLSARRPNLQVIMCSSRSLKTSVLILKSYAILKDAILKDHT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain