SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma04g36841

Feature Type:gene_model
Chromosome:Gm04
Start:43338679
stop:43343309
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G38180AT Annotation by Michelle Graham. TAIR10: FAR1-related sequence 5 | chr4:17906702-17909404 REVERSE LENGTH=788 SoyBaseE_val: 3.00E-27ISS
GO:0009639GO-bp Annotation by Michelle Graham. GO Biological Process: response to red or far red light SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF10551PFAM MULE transposase domain JGI ISS
UniRef100_I1JXG8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JXG8_SOYBN SoyBaseE_val: 1.00E-141ISS
UniRef100_Q2QZM0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transposon protein, putative, unclassified n=1 Tax=Oryza sativa Japonica Group RepID=Q2QZM0_ORYSJ SoyBaseE_val: 2.00E-27ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g36841 not represented in the dataset

Glyma04g36841 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g193200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g36841.1   sequence type=CDS   gene model=Glyma04g36841   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGGAAAAGCTCCATCTTCAGTTATAACAGATGGTGATGTCGCAATGAACAATGCAATTAGACGTGTTTTCCCAAATGCATTTCACCGGCATTGTGCATGGCATTTGATAAGGAATGCACAAAGTCATTTGAAGAACACTGACATTTTGCCTTTCTTGAAAAGACTAATGTTAATTGAACTTGAGGCGTCTGAATTTGAACAAAAATGGAATGAAATGGTGTCCAGGTTTGGGCTGCAGGATAATACTTGGTTGAATGAGTTATATGTCAAAAGGAGGATGTGGTCTCCTGCGCATATTTGTGGGAATTTCTTTGCCGGTATTAGGATGGCATCACGTTGTGAAGCCTTACATGACCACATTGGAAAATATGTTGATTCAAGAACTAACTTGATTGATTTTGTGGAGCAATTTCATAGGTGTTTGACCTTTTTCCGATACCGAGAGATTGAAGTTGATTATTTTGATTATGGGGATGTTATTGTAGAAACAAATTTCCATTCCATGGAGAGGAGTGCTGGTCAAATTCTCACTAATGAGTTGTTTTTGGCTTTCCAATCGTGTCTTAAAAAAACTTAA

>Glyma04g36841.1   sequence type=predicted peptide   gene model=Glyma04g36841   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNGKAPSSVITDGDVAMNNAIRRVFPNAFHRHCAWHLIRNAQSHLKNTDILPFLKRLMLIELEASEFEQKWNEMVSRFGLQDNTWLNELYVKRRMWSPAHICGNFFAGIRMASRCEALHDHIGKYVDSRTNLIDFVEQFHRCLTFFRYREIEVDYFDYGDVIVETNFHSMERSAGQILTNELFLAFQSCLKKT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo