Glyma04g36480 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g36480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g36480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g36480

Feature Type:	gene_model
Chromosome:	Gm04
Start:	43000688
stop:	43002950
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g36480

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G61640	AT	Annotation by Michelle Graham. TAIR10: peptidemethionine sulfoxide reductase 1 \| chr5:24775107-24776147 FORWARD LENGTH=202	SoyBase	E_val: 4.00E-85	ISS
GO:0006464	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular protein modification process	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0019538	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein metabolic process	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0008113	GO-mf	Annotation by Michelle Graham. GO Molecular Function: peptide-methionine (S)-S-oxide reductase activity	SoyBase	N/A	ISS
GO:0016671	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	SoyBase	N/A	ISS
KOG1635	KOG	Peptide methionine sulfoxide reductase	JGI		ISS
PTHR10173	Panther	METHIONINE SULFOXIDE REDUCTASE	JGI		ISS
PTHR10173:SF6	Panther	METHIONINE SULFOXIDE REDUCTASE	JGI		ISS
PF01625	PFAM	Peptide methionine sulfoxide reductase	JGI		ISS
UniRef100_C6T389	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T389_SOYBN	SoyBase	E_val: 6.00E-143	ISS
UniRef100_H2ESC5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peptide methionine sulfoxide reductase MsrA n=1 Tax=Morus alba var. multicaulis RepID=H2ESC5_MORAL	SoyBase	E_val: 2.00E-117	ISS

Expression Patterns of Glyma04g36480

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g36480 not represented in the dataset	Glyma04g36480 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g36480 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g190800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g36480

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g36480

Limit To All Plant Sequences

>Glyma04g36480.1   sequence type=CDS   gene model=Glyma04g36480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCAGTGGAGGCGATGAGGGGCAGAACAACCCTGCCCTCGACCCGGATTTGGATGCTCCGGATGACCCGGATCACGAGTTCGCTGAGTTCGGGTCGGGTTGCTTCTGGGGTGCTGAGTTGGCCTTTCAGCGAGTTGTGGGTGTGGTGAAGACTGAGGTTGGTTACACTCAGGGTCACACTCCGGATCCGAATTACAAACTGGTTTGCACCGGAACCACTAACCACGTTGAAGTGGTTCGGGTCCAGTTCGACCCGAAGGTTTGCCCCTACAATGATCTACTCGCTCTCTTTTGGTCTCGGCATGACCCCACTTCCATCAACCGTCAGGGCAATGATGTGGGTGCACAGTATAGATCAGGAATATACTACTACAACGATACCCAAGCTCGTTTAGGCCAGGAATCAAAAGATGCAAAACAATTGGAACTGAAGGAGAAGATTGTGACAGAAATACTTCCAGCAAAGAGGTTTTACAAAGCAGAGGAATACCATCAACAATATCTGGAGAAGGGTGGAGGTCAAGGCAACAAACAATCCGCAGAAAAAGGCTGCACTGATCCCATCAGGTGCTATGGCTGA

Predicted protein sequences of Glyma04g36480

Limit To All Plant Sequences

>Glyma04g36480.1   sequence type=predicted peptide   gene model=Glyma04g36480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATSGGDEGQNNPALDPDLDAPDDPDHEFAEFGSGCFWGAELAFQRVVGVVKTEVGYTQGHTPDPNYKLVCTGTTNHVEVVRVQFDPKVCPYNDLLALFWSRHDPTSINRQGNDVGAQYRSGIYYYNDTQARLGQESKDAKQLELKEKIVTEILPAKRFYKAEEYHQQYLEKGGGQGNKQSAEKGCTDPIRCYG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain