SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g36386): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g36386): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g36386

Feature Type:gene_model
Chromosome:Gm04
Start:42917021
stop:42918943
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24750AT Annotation by Michelle Graham. TAIR10: Rhodanese/Cell cycle control phosphatase superfamily protein | chr4:12758422-12760749 REVERSE LENGTH=292 SoyBaseE_val: 5.00E-56ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006399GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA metabolic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0045036GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR13253Panther FAMILY NOT NAMED JGI ISS
PTHR13253:SF10Panther SUBFAMILY NOT NAMED JGI ISS
PF00581PFAM Rhodanese-like domain JGI ISS
UniRef100_Q0WWT7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rhodanese-like domain-containing protein 11, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=STR11_ARATH SoyBaseE_val: 3.00E-53ISS
UniRef100_UPI0002339AAFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339AAF related cluster n=1 Tax=unknown RepID=UPI0002339AAF SoyBaseE_val: 2.00E-72ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g36386 not represented in the dataset

Glyma04g36386 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma06g18510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g189800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g36386.1   sequence type=CDS   gene model=Glyma04g36386   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATTTTATTGTTCGGTTCTTCAACAACCAGTTCTTAGACAAAGTTGAGGAGAAGTTCCCCAAAGATGCTGAATTAATTGTTGCATGCCAGAAGGGACTGAGATCACTTGCTGCTTGTGAACTACTGTATAATGCTGGCTATAAAAATCTGTTTTGGGTTCAAGGAGGATATGAAGCTGCTGAAGGAGAGGATTTCATTGTAGAGGGCCCCAGTGCCTCTCAAGTTTTCTGGAATTGGATATGGTTGCAAATTTCCGACTTCATAATTATTTCCAGTTGGACTGATCAACAAAGAGCAGCTGCAGCCAAGGAAGGTTGGGGATATAGATTAGTGTTTTCTGCACGCCTGATTGGAGTCTTTCTCGTTGCCGATGCCCTATATTTTGGTGCTCAGCAAATTGGGCGCTATCTTCAGGATATCTGGACCCATTGA

>Glyma04g36386.1   sequence type=predicted peptide   gene model=Glyma04g36386   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNFIVRFFNNQFLDKVEEKFPKDAELIVACQKGLRSLAACELLYNAGYKNLFWVQGGYEAAEGEDFIVEGPSASQVFWNWIWLQISDFIIISSWTDQQRAAAAKEGWGYRLVFSARLIGVFLVADALYFGAQQIGRYLQDIWTH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo