SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g36341

Feature Type:gene_model
Chromosome:Gm04
Start:42894365
stop:42895235
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g36341
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G26180AT Annotation by Michelle Graham. TAIR10: cytochrome P450, family 71, subfamily B, polypeptide 20 | chr3:9578407-9579993 REVERSE LENGTH=368 SoyBaseE_val: 2.00E-23ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0004497GO-mf Annotation by Michelle Graham. GO Molecular Function: monooxygenase activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF00067PFAM Cytochrome P450 JGI ISS
UniRef100_O48918UniRef Annotation by Michelle Graham. Most informative UniRef hit: CYP71A10 n=1 Tax=Glycine max RepID=O48918_SOYBN SoyBaseE_val: 4.00E-42ISS
UniRef100_UPI0002339AADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339AAD related cluster n=1 Tax=unknown RepID=UPI0002339AAD SoyBaseE_val: 2.00E-91ISS

Expression Patterns of Glyma04g36341
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g36341 not represented in the dataset
Glyma04g36341 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g36341 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g189500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g36341
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g36341
>Glyma04g36341.1   sequence type=CDS   gene model=Glyma04g36341   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAACCACGTTCCTTGCAGTAGATGCTTTCCTTGACGAGATAATTGTAGAACACGAGAGCAATAATAAGAAGAATGATGACTTCTTGGGGATACTCCTTCAACTTCAAGAGTGTGGAAGGCTTGACTTTCAGCACGTCCGAGATAACCTCAAAACAATCCTTATGAAAAAGATGCATGAATACCCAACTTCAACTTGTATATTAATTTCAGGAATGATAATAGAAACATCATCTAGTGTCAAACTAAGAGGGTACCATACTACTACCAAAATAATGGTATTTATTAATGCATCAACAATCCAAAGGGATACTAAATTATGGGACGATCCTGGAGAGTTCATTCCTAAAAGATTTGAAACTAACCAAGTTGATTTTAATGGACAAGATTTTCAATTAATCTCGTTCAGTATTGGGAGAAAGGGATGTCCTACAATGTCATTTGGGCTTGCTTCCGCTCAGTATGTTCTTTCTAATCTTTTGTATTGGTTCAATTGA
Predicted protein sequences of Glyma04g36341
>Glyma04g36341.1   sequence type=predicted peptide   gene model=Glyma04g36341   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTTFLAVDAFLDEIIVEHESNNKKNDDFLGILLQLQECGRLDFQHVRDNLKTILMKKMHEYPTSTCILISGMIIETSSSVKLRGYHTTTKIMVFINASTIQRDTKLWDDPGEFIPKRFETNQVDFNGQDFQLISFSIGRKGCPTMSFGLASAQYVLSNLLYWFN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo