SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g36246

Feature Type:gene_model
Chromosome:Gm04
Start:42794623
stop:42799268
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g36246
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G56280AT Annotation by Michelle Graham. TAIR10: drought-induced 19 | chr1:21073366-21074725 REVERSE LENGTH=200 SoyBaseE_val: 7.00E-10ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
PF05605PFAM Drought induced 19 protein (Di19) JGI ISS
UniRef100_B6SGL8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Fb2 n=1 Tax=Zea mays RepID=B6SGL8_MAIZE SoyBaseE_val: 7.00E-10ISS
UniRef100_I1KCB0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCB0_SOYBN SoyBaseE_val: 4.00E-119ISS

Expression Patterns of Glyma04g36246
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g36246 not represented in the dataset
Glyma04g36246 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g36246
ParalogEvidenceComments
Glyma06g18650 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g36246 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g188600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g36246
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g36246
>Glyma04g36246.1   sequence type=CDS   gene model=Glyma04g36246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACTTGGACTTCAGGAGGGCTTCAACCATTCATTCCACCAATCATCACTTCTCTTCTCTCCAACCTTCTCGCCTTCACTCTGATGATGATGATGATGCTCGATCTCTTCTTCAATGTCCTTCCTGTGATTTTGAGATTGATTTTTCGTCAGCCCATACCCATTTGGAAGAGATGCACTGCTATGACCCAAAAAATCTGCTATGTCCTGTGTGTGATGAAACATTAGGGGAGGAAGCAATCTGGGTTGCACAGAATTCAAGTGCACAAAAGAGAGCTTGGAAGTCTGACAAATCTAGCATTAGCATCTCGTCAGGTGATTCAGTAGTAGTGCTTGAAAAGAAACTTCCTGCCAGGGGAAGCAAACATGAACCAGTGCCTGATCCAGTTTTGTCACCGTTTGTCGGCAATGTGTCTGTTCCAAACTCCAGTGGCATCCATCCTGGTGAAGGTTCCTCCAGGAATGCCACGTACATTTCCAATGCAAAAGGCTCTGGGACAGATGCACCCCAGGATTCAGGTGATGAGCAGGATATTGAAGAGAGAAGGCTGAGGGCATCTTTTGTTCAGGAGTTGTTATCGTCAGCTTTAATCTAG
Predicted protein sequences of Glyma04g36246
>Glyma04g36246.1   sequence type=predicted peptide   gene model=Glyma04g36246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDLDFRRASTIHSTNHHFSSLQPSRLHSDDDDDARSLLQCPSCDFEIDFSSAHTHLEEMHCYDPKNLLCPVCDETLGEEAIWVAQNSSAQKRAWKSDKSSISISSGDSVVVLEKKLPARGSKHEPVPDPVLSPFVGNVSVPNSSGIHPGEGSSRNATYISNAKGSGTDAPQDSGDEQDIEERRLRASFVQELLSSALI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo