SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g36101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g36101): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g36101

Feature Type:gene_model
Chromosome:Gm04
Start:42597160
stop:42598337
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G63110AT Annotation by Michelle Graham. TAIR10: histone deacetylase 6 | chr5:25315834-25318227 REVERSE LENGTH=471 SoyBaseE_val: 2.00E-72ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0016441GO-bp Annotation by Michelle Graham. GO Biological Process: posttranscriptional gene silencing SoyBaseN/AISS
GO:0016458GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing SoyBaseN/AISS
GO:0016575GO-bp Annotation by Michelle Graham. GO Biological Process: histone deacetylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0004407GO-mf Annotation by Michelle Graham. GO Molecular Function: histone deacetylase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR10625Panther HISTONE DEACETYLASE JGI ISS
PTHR10625:SF28Panther HISTONE DEACETYLASE 1, 2 ,3 JGI ISS
PF00850PFAM Histone deacetylase domain JGI ISS
UniRef100_I1JXA8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone deacetylase n=1 Tax=Glycine max RepID=I1JXA8_SOYBN SoyBaseE_val: 1.00E-92ISS
UniRef100_I1JXA8UniRef Annotation by Michelle Graham. Best UniRef hit: Histone deacetylase n=1 Tax=Glycine max RepID=I1JXA8_SOYBN SoyBaseE_val: 1.00E-92ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g36101 not represented in the dataset

Glyma04g36101 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g187100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g36101.1   sequence type=CDS   gene model=Glyma04g36101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACAAGGGAGAGAGCAGAAATAGAGAATGGTGTTTCATTACCATCTGTGGGTATGGATGCAAATAAGCGTAGAGTGACATATTTCTACAAACCGAACATCGACGCCCACTATCATGGTGAAGAGTACCCAATGAATCCTTTTCGTGTTGACATTACCCACAACCTCATCGTCCACTATGGGCTACATCGACTCATGCAAATCAATCGCCCTTTCCTTGCCGACAAGGTTGACATTGCTCGCTTCCATTCCGATGACTATGTCGAGTTCCTGTCCACTGTTTCACCACAGATCCTTGCTGAAAACTTTGATTCCAACTATTGCCAACTTAAGCGCTTCAACATCGGTGGGGATTTCCCTATCTTGAACGGCCTTTTCGACTTTTGTCGTGTCTCTGCTGGCGGCTCTATCGGTGCTGCTGTTTGCCTAAACTGCTCCAATGCCGACATCACCATCAATTGGGCTGGGGGTTGGCACCATGCTAAAAAGACTAAAGCCTCTGGATTTTGCTACGTCAACGACATTGTTCTTGGCATTCTTGAACTTCTCAAAGTTCATAGGGTATTGGAATTTTGTGATTTTGGTCCCTAA

>Glyma04g36101.1   sequence type=predicted peptide   gene model=Glyma04g36101   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATRERAEIENGVSLPSVGMDANKRRVTYFYKPNIDAHYHGEEYPMNPFRVDITHNLIVHYGLHRLMQINRPFLADKVDIARFHSDDYVEFLSTVSPQILAENFDSNYCQLKRFNIGGDFPILNGLFDFCRVSAGGSIGAAVCLNCSNADITINWAGGWHHAKKTKASGFCYVNDIVLGILELLKVHRVLEFCDFGP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo