SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g35801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g35801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g35801

Feature Type:gene_model
Chromosome:Gm04
Start:42284386
stop:42284892
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76680AT Annotation by Michelle Graham. TAIR10: 12-oxophytodienoate reductase 1 | chr1:28776982-28778271 FORWARD LENGTH=372 SoyBaseE_val: 2.00E-27ISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0010150GO-bp Annotation by Michelle Graham. GO Biological Process: leaf senescence SoyBaseN/AISS
GO:0031407GO-bp Annotation by Michelle Graham. GO Biological Process: oxylipin metabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0010181GO-mf Annotation by Michelle Graham. GO Molecular Function: FMN binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016629GO-mf Annotation by Michelle Graham. GO Molecular Function: 12-oxophytodienoate reductase activity SoyBaseN/AISS
PTHR22893Panther NADH OXIDOREDUCTASE-RELATED JGI ISS
PTHR22893:SF13Panther 12-OXOPHYTODIENOATE REDUCTASE OPR JGI ISS
PF00724PFAM NADH:flavin oxidoreductase / NADH oxidase family JGI ISS
UniRef100_C6TDQ8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TDQ8_SOYBN SoyBaseE_val: 7.00E-41ISS
UniRef100_Q76FR9UniRef Annotation by Michelle Graham. Most informative UniRef hit: 12-oxophytodienoic acid 10, 11-reductase n=1 Tax=Pisum sativum RepID=Q76FR9_PEA SoyBaseE_val: 3.00E-27ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g35801 not represented in the dataset

Glyma04g35801 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g184800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g35801.1   sequence type=CDS   gene model=Glyma04g35801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGAACAAAAAAATCAGGTCATCCCTCTTCTTACTCCTTACAAGATGGGGAACTTAAATCTTTCACACAGAATCGTTTTGGCGCCACTATTTAGAGCAAGATCTTACAACAACTTTGCTCAGCCGCATGCTATTCTATATTACTCTCAAAGAGCTACCAAGGGAGGTCTTCTGATTACTGAAGCTACTACTATTTCACCCACTTCTAAATTGTACGTAATTTGCATTTAA

>Glyma04g35801.1   sequence type=predicted peptide   gene model=Glyma04g35801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVEQKNQVIPLLTPYKMGNLNLSHRIVLAPLFRARSYNNFAQPHAILYYSQRATKGGLLITEATTISPTSKLYVICI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo