SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g34830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g34830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g34830

Feature Type:gene_model
Chromosome:Gm04
Start:41084948
stop:41089615
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g34830
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46505AT Annotation by Michelle Graham. TAIR10: succinate dehydrogenase subunit 4 | chr2:19090013-19090468 REVERSE LENGTH=151 SoyBaseE_val: 9.00E-12ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006099GO-bp Annotation by Michelle Graham. GO Biological Process: tricarboxylic acid cycle SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005749GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex II SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008177GO-mf Annotation by Michelle Graham. GO Molecular Function: succinate dehydrogenase (ubiquinone) activity SoyBaseN/AISS
UniRef100_I1JX20UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JX20_SOYBN SoyBaseE_val: 5.00E-154ISS
UniRef100_Q8RVA9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Succinate dehydrogenase subunit 4 n=1 Tax=Pisum sativum RepID=Q8RVA9_PEA SoyBaseE_val: 1.00E-96ISS

Expression Patterns of Glyma04g34830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g34830 not represented in the dataset
Glyma04g34830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g34830 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g178000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g34830
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g34830
>Glyma04g34830.1   sequence type=CDS   gene model=Glyma04g34830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAATCTATGTCCCTGACGCTGAGCAAGAGGCTCTCCAATTCAAAGCCTCTCTTCAGAATCTCTTCCAGCCTCGTCGCTCACGCATCCTCCGCCACAACCTCTCCGCCGCCACCTTCGCCGCCAGTCCCCTCTCCCTCCGCCCTCAACAGCCTCCTCACCGCTCCGTGGTCCGCCACTCAGTCACGCGGAATCACGCTTTCCGGATCTGATATTAGAGTCGGGAATCTCATTGGAAACCGAGGACGCGCTCACGAGGTTCTCAAACTGTATCGCCCTCTTGAAGGAACGGGCAAAGCCACTCTTGAGGTTCCGCCTCAAAGTGTAGCTGGTTATGCCACAGTTGCTACTACAGAGGATGGTGCCGAAAGGAAGGAACGAAACAGTGGATTGAGTAAGGCAACGAAGACAAAGAGAGAGCAGCTCCTAAAAGCTACTGCAGTTGCCTCTCTTCTTCTAATATACCCGAACACTTATTCATTGCTCTTCGCAAATTTCTTTGTGTTCTGGCACTTATATGCAGGGATCGGAGAGATTTTGGCAGACTATGTTCACCATGAAATGACCAGAGAATTTGTCATGATTTCTCTCAGGTTGTTCTTGATAATCGCATTGAAGGATGTTTGCTTAAATTTTGTATTTGTATAA
Predicted protein sequences of Glyma04g34830
>Glyma04g34830.1   sequence type=predicted peptide   gene model=Glyma04g34830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSMSLTLSKRLSNSKPLFRISSSLVAHASSATTSPPPPSPPVPSPSALNSLLTAPWSATQSRGITLSGSDIRVGNLIGNRGRAHEVLKLYRPLEGTGKATLEVPPQSVAGYATVATTEDGAERKERNSGLSKATKTKREQLLKATAVASLLLIYPNTYSLLFANFFVFWHLYAGIGEILADYVHHEMTREFVMISLRLFLIIALKDVCLNFVFV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo