Glyma04g34273 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g34273): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g34273): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g34273

Feature Type:	gene_model
Chromosome:	Gm04
Start:	40398542
stop:	40399383
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g34273

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G46620	AT	Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein \| chr2:19139071-19140546 REVERSE LENGTH=491	SoyBase	E_val: 4.00E-31	ISS
GO:0009693	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
PTHR23070	Panther	BCS1 AAA-TYPE ATPASE	JGI		ISS
PTHR23070:SF1	Panther	AAA-TYPE ATPASE-RELATED	JGI		ISS
UniRef100_G7L522	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial chaperone BCS1 n=1 Tax=Medicago truncatula RepID=G7L522_MEDTR	SoyBase	E_val: 2.00E-30	ISS
UniRef100_I1NCP2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NCP2_SOYBN	SoyBase	E_val: 1.00E-34	ISS

Expression Patterns of Glyma04g34273

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g34273 not represented in the dataset	Glyma04g34273 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g34273 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g174000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g34273

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g34273

Limit To All Plant Sequences

>Glyma04g34273.1   sequence type=CDS   gene model=Glyma04g34273   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATGGAACTAGATCGCAAAAACAAGGTCAAATCTGATCTCGAATCCTTCCTCAGAGCGAAACGGTACTACCACCGCCTCGGTCGTGTCTGGCAAAAGAGCTTCCTTCTGTACGGTACCTCCGGCACCGGAAAATCGAGCTTCGTCGCCGCCATCGTCAATTTCCTCTCCTACGACATCGACCTCTGCCAAATCCCTAGCGATTCGGATCTGAAATTGCTCCTCCTCAAAACGACGCCGAGTTGGGCTATTAAATCGGTTATCACTGCCTTGCAAGCAAACGGTGATGGCAGAAGGTGCGGCTTGATCAGACGGAAGACGGAGGATGATCTAATGGATGAACCATATGGGGTTGTGTGCGATGAGGATCTCCATAAGTTAAGGATTTGCGGAAACTGTACGATTTTGGGGGGCAAGCTTTTTTTGTTCATAGCCGAATTAGACACAACGTTTGTTCATTGGATGCAACATTGGAATTAG

Predicted protein sequences of Glyma04g34273

Limit To All Plant Sequences

>Glyma04g34273.1   sequence type=predicted peptide   gene model=Glyma04g34273   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMELDRKNKVKSDLESFLRAKRYYHRLGRVWQKSFLLYGTSGTGKSSFVAAIVNFLSYDIDLCQIPSDSDLKLLLLKTTPSWAIKSVITALQANGDGRRCGLIRRKTEDDLMDEPYGVVCDEDLHKLRICGNCTILGGKLFLFIAELDTTFVHWMQHWN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain