|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G64740 | AT | Annotation by Michelle Graham. TAIR10: cellulose synthase 6 | chr5:25881555-25886333 FORWARD LENGTH=1084 | SoyBase | E_val: 6.00E-41 | ISS |
| GO:0000271 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process | SoyBase | N/A | ISS |
| GO:0009664 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization | SoyBase | N/A | ISS |
| GO:0009825 | GO-bp | Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth | SoyBase | N/A | ISS |
| GO:0009832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis | SoyBase | N/A | ISS |
| GO:0009833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: primary cell wall biogenesis | SoyBase | N/A | ISS |
| GO:0009932 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell tip growth | SoyBase | N/A | ISS |
| GO:0010583 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone | SoyBase | N/A | ISS |
| GO:0010817 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels | SoyBase | N/A | ISS |
| GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS |
| GO:0030243 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process | SoyBase | N/A | ISS |
| GO:0030244 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process | SoyBase | N/A | ISS |
| GO:0042546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis | SoyBase | N/A | ISS |
| GO:0043481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light | SoyBase | N/A | ISS |
| GO:0043622 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cortical microtubule organization | SoyBase | N/A | ISS |
| GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
| GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0010005 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cortical microtubule, transverse to long axis | SoyBase | N/A | ISS |
| GO:0010330 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cellulose synthase complex | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0016757 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups | SoyBase | N/A | ISS |
| GO:0016759 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity | SoyBase | N/A | ISS |
| GO:0016760 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity | SoyBase | N/A | ISS |
| PTHR13301 | Panther | X-BOX TRANSCRIPTION FACTOR-RELATED | JGI | ISS | |
| PTHR13301:SF1 | Panther | TGACG-MOTIF-BINDING FACTOR | JGI | ISS | |
| PF03552 | PFAM | Cellulose synthase | JGI | ISS | |
| UniRef100_G7IBY3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase n=1 Tax=Medicago truncatula RepID=G7IBY3_MEDTR | SoyBase | E_val: 6.00E-47 | ISS |
| UniRef100_I1LDF0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LDF0_SOYBN | SoyBase | E_val: 7.00E-50 | ISS |
|
Glyma04g34241 not represented in the dataset |
Glyma04g34241 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g173700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g34241.1 sequence type=CDS gene model=Glyma04g34241 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTATGTACAATTTCCTCAAAGATTGATGGGATTGATCATCATGATAGATACTCAAATAAAAATATTGTATTCTTTGATATAAACATGAAAGGTTTAGATGGCATCCAAGGACCAATATATGTGGGAACTGGGTGTGCCTTTAGGTGGCAGGCGCTCTATGGATATGATGCCCCTGCTACGAAGAAACCACCAAGGAAACCTTGTAACTGTTGGCCCAAATGGTGCTACCTGTGTTGTGGATCTAGGAACAAGAATAGGAAAGTGAAGTCAGGTCCAAGAAAGAAGATAAAAAAATAA
>Glyma04g34241.1 sequence type=predicted peptide gene model=Glyma04g34241 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLCTISSKIDGIDHHDRYSNKNIVFFDINMKGLDGIQGPIYVGTGCAFRWQALYGYDAPATKKPPRKPCNCWPKWCYLCCGSRNKNRKVKSGPRKKIKK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||