Glyma04g33831 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g33831): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g33831): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g33831

Feature Type:	gene_model
Chromosome:	Gm04
Start:	39613859
stop:	39615916
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g33831

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G47990	AT	Annotation by Michelle Graham. TAIR10: SUGAR-INSENSITIVE 3 \| chr3:17713367-17716051 REVERSE LENGTH=358	SoyBase	E_val: 7.00E-49	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0010182	GO-bp	Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway	SoyBase	N/A	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
UniRef100_B9RB36	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9RB36_RICCO	SoyBase	E_val: 7.00E-59	ISS
UniRef100_UPI0002339E2E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339E2E related cluster n=1 Tax=unknown RepID=UPI0002339E2E	SoyBase	E_val: 3.00E-63	ISS

Expression Patterns of Glyma04g33831

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g33831 not represented in the dataset	Glyma04g33831 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g33831 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g170900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g33831

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma04g33831

Limit To All Plant Sequences

>Glyma04g33831.2   sequence type=transcript   gene model=Glyma04g33831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAGATGAAGTCAAATGATGTTTTAATTCATCAAGTCTCGGTACTAATTCAATTGCGCTTTTATGCCCCCTCCCCCTTTGTATGCTTCTAGAGATTTTGGTTGGCAACAGAGATATGCCTGTTTCTGTGGAAGAGTAGTTGTCCTTTCAATCCTTGTGTTGCTTCTTTATCCATTTCTTTGGGCTTGGACTGTAATTGGTACCCTGTGGTTCAGCAGTGCCAAGAATTGTTTGCCTGAAGTGGTTAAAAAATGGGGCTTTCTCATCTGGTTACTTTTTAGCTATTGTGGACTCTTTTGCATTGCTTGCTTGTCTCTGGCCCGTAGTAGTTTCTTGCACGGTGGCATTTTTGTAATATTAGCTTCTTCATCAACGACGGAGTTTGGGAAGTTTATTGGGCAGTGTCAGTGGGAAGAAAGGTCAAGATGA

Coding sequences of Glyma04g33831

Limit To All Plant Sequences

>Glyma04g33831.1   sequence type=CDS   gene model=Glyma04g33831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATCAGAGGCGTCGATTTCAAGTGGTACGATGACTTTTTCTTGTTAATGCTCGCCACCAGTGTCAACTACACCATTGTGTTTACTTTCCGGGTATTGATGTTTATTGATAACGGGCTTTCTACAAGAATGGGTTTAGATTTTGGTTGGCAACAGAGATATGCCTGTTTCTGTGGAAGAGTAGTTGTCCTTTCAATCCTTGTGTTGCTTCTTTATCCATTTCTTTGGGCTTGGACTGTAATTGGTACCCTGTGGTTCAGCAGTGCCAAGAATTGTTTGCCTGAAGTGGTTAAAAAATGGGGCTTTCTCATCTGGTTACTTTTTAGCTATTGTGGACTCTTTTGCATTGCTTGCTTGTCTCTGGCCCGTAGTAGTTTCTTGCACGGTGGCATTTTTGTAATATTAGCTTCTTCATCAACGACGGAGTTTGGGAAGTTTATTGGGCAGTGTCAGTGGGAAGAAAGGTCAAGATGA

>Glyma04g33831.2   sequence type=CDS   gene model=Glyma04g33831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCCCTCCCCCTTTGTATGCTTCTAGAGATTTTGGTTGGCAACAGAGATATGCCTGTTTCTGTGGAAGAGTAGTTGTCCTTTCAATCCTTGTGTTGCTTCTTTATCCATTTCTTTGGGCTTGGACTGTAATTGGTACCCTGTGGTTCAGCAGTGCCAAGAATTGTTTGCCTGAAGTGGTTAAAAAATGGGGCTTTCTCATCTGGTTACTTTTTAGCTATTGTGGACTCTTTTGCATTGCTTGCTTGTCTCTGGCCCGTAGTAGTTTCTTGCACGGTGGCATTTTTGTAATATTAGCTTCTTCATCAACGACGGAGTTTGGGAAGTTTATTGGGCAGTGTCAGTGGGAAGAAAGGTCAAGATGA

Predicted protein sequences of Glyma04g33831

Limit To All Plant Sequences

>Glyma04g33831.1   sequence type=predicted peptide   gene model=Glyma04g33831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIRGVDFKWYDDFFLLMLATSVNYTIVFTFRVLMFIDNGLSTRMGLDFGWQQRYACFCGRVVVLSILVLLLYPFLWAWTVIGTLWFSSAKNCLPEVVKKWGFLIWLLFSYCGLFCIACLSLARSSFLHGGIFVILASSSTTEFGKFIGQCQWEERSR*

>Glyma04g33831.2   sequence type=predicted peptide   gene model=Glyma04g33831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPPPLYASRDFGWQQRYACFCGRVVVLSILVLLLYPFLWAWTVIGTLWFSSAKNCLPEVVKKWGFLIWLLFSYCGLFCIACLSLARSSFLHGGIFVILASSSTTEFGKFIGQCQWEERSR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain