Glyma04g33610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g33610

Feature Type:	gene_model
Chromosome:	Gm04
Start:	39240661
stop:	39242267
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g33610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G15230	AT	Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 4 \| chr5:4945017-4946025 FORWARD LENGTH=106	SoyBase	E_val: 4.00E-42	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02704	PFAM	Gibberellin regulated protein	JGI		ISS
UniRef100_I1JWV1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JWV1_SOYBN	SoyBase	E_val: 5.00E-70	ISS
UniRef100_Q49RB3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gip1-like protein n=1 Tax=Populus tomentosa RepID=Q49RB3_POPTO	SoyBase	E_val: 5.00E-48	ISS

Expression Patterns of Glyma04g33610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma04g33610

Paralog	Evidence	Comments
Glyma06g20830	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma04g33610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.04g169600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma04g33610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g33610

Limit To All Plant Sequences

>Glyma04g33610.1   sequence type=CDS   gene model=Glyma04g33610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAAGGTTTTCTGTGTTCTGCTTCTGGCACTCCTTGGCATTTCCATGATCACAACTCAGGTTATGGCAACAGATTCTGCTTATCACTTGGATGGAAGGAATTATGGACCTGGGAGTCTCAAGAGCTCACAGTGCCCTTCTGAATGCACAAGAAGATGTAGCCAGACACAGTACCACAAGCCCTGCATGGTCTTCTGCAAACAATGCTGCAAAAGGTGCCTTTGTGTTCCTCCTGGCTACTATGGGAACAAGTCTGTGTGCCCCTGCTACAATAACTGGAAGACCAAGCGTGGAGGACCCAAATGCCCCTGA

Predicted protein sequences of Glyma04g33610

Limit To All Plant Sequences

>Glyma04g33610.1   sequence type=predicted peptide   gene model=Glyma04g33610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKVFCVLLLALLGISMITTQVMATDSAYHLDGRNYGPGSLKSSQCPSECTRRCSQTQYHKPCMVFCKQCCKRCLCVPPGYYGNKSVCPCYNNWKTKRGGPKCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain