SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g33056): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g33056): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g33056

Feature Type:gene_model
Chromosome:Gm04
Start:38467000
stop:38467539
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g33056
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G23490AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF604) | chr4:12251580-12253973 REVERSE LENGTH=526 SoyBaseE_val: 3.00E-76ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
PTHR10811Panther BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASE RADICAL FRINGE JGI ISS
PTHR10811:SF5Panther RADICAL FRINGE JGI ISS
PF04646PFAM Protein of unknown function, DUF604 JGI ISS
UniRef100_B9RCG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transferase, transferring glycosyl groups, putative n=1 Tax=Ricinus communis RepID=B9RCG0_RICCO SoyBaseE_val: 1.00E-77ISS
UniRef100_I1KPE3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KPE3_SOYBN SoyBaseE_val: 2.00E-98ISS

Expression Patterns of Glyma04g33056
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g33056 not represented in the dataset
Glyma04g33056 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g33056 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g166000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g33056
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g33056
>Glyma04g33056.1   sequence type=CDS   gene model=Glyma04g33056   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATCCTGAGGACCGAACGGACCTCCGCCACTTGGTGTTCGGAATCGCGGTGTCGACCAAGCTATGGGACCAAAGGAAGAGCTACATCAAACTTAGGTACAGAGTAAGGGACATGCGCGACATTATGTGGCTCAACGAGAAGGTGAAATCGAAGGAAAACAACAGCGACGTGCTCCCGCCGCTGAGAATCTTCGATGACATGGTGATGTTTATGTATACAAACAGGCAAGGGCACCGATTGACAATTAGGATCTCACGGATTGTGTCGGAGACACTACAGCTGGGGATGAAGGATGTGCGGTGGTTTGCGATGGGCGATGATGACACCATTTTCGTCATTGAAAACCTAATTCGCATTTTGAGAAAATACGACCACAATCAGCTCTATTGCATTGGGAGTTTGTCGGAGAGTCACTTGCAGAACATTTTTTTCTCTTACAACATGGCCTATGGCGGAGGAGGCTTTGCAATTAGTTATCCTCTCGCAAAGGCTCTTCACAAATTGCAGGACCGTGAAGGAGGAGCTCTTTTGTTTTAG
Predicted protein sequences of Glyma04g33056
>Glyma04g33056.1   sequence type=predicted peptide   gene model=Glyma04g33056   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNPEDRTDLRHLVFGIAVSTKLWDQRKSYIKLRYRVRDMRDIMWLNEKVKSKENNSDVLPPLRIFDDMVMFMYTNRQGHRLTIRISRIVSETLQLGMKDVRWFAMGDDDTIFVIENLIRILRKYDHNQLYCIGSLSESHLQNIFFSYNMAYGGGGFAISYPLAKALHKLQDREGGALLF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo