Glyma04g32770 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g32770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g32770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g32770

Feature Type:	gene_model
Chromosome:	Gm04
Start:	37905061
stop:	37906882
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g32770

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G57410	AT	Annotation by Michelle Graham. TAIR10: villin 3 \| chr3:21243615-21249809 REVERSE LENGTH=965	SoyBase	E_val: 4.00E-30	ISS
GO:0000902	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell morphogenesis	SoyBase	N/A	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0009832	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0030243	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process	SoyBase	N/A	ISS
GO:0032880	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein localization	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0051014	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament severing	SoyBase	N/A	ISS
GO:0051017	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin filament bundle assembly	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0003779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin binding	SoyBase	N/A	ISS
GO:0051015	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin filament binding	SoyBase	N/A	ISS
PTHR11977	Panther	VILLIN	JGI		ISS
PTHR11977:SF9	Panther	FLIGHTLESS-1-RELATED	JGI		ISS
PF02209	PFAM	Villin headpiece domain	JGI		ISS
UniRef100_G7KTI5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Villin-2 n=1 Tax=Medicago truncatula RepID=G7KTI5_MEDTR	SoyBase	E_val: 1.00E-59	ISS
UniRef100_UPI000233E8D5	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E8D5 related cluster n=1 Tax=unknown RepID=UPI000233E8D5	SoyBase	E_val: 6.00E-101	ISS

Expression Patterns of Glyma04g32770

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g32770 not represented in the dataset	Glyma04g32770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g32770 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g32770

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g32770

Limit To All Plant Sequences

>Glyma04g32770.1   sequence type=CDS   gene model=Glyma04g32770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGACCACGACAAAGAGCAGAAGCTTTGGCTACCTTAAATAATGCATTCAATTCATCTCCTGAGACAACATCCAGTGCGATTCCCCTGATAGGAAAAGGAGGGCATAGGGATAAGTTGAATGGGTTAAATCGAGGAGGACCGAGACAAAGGGCAGAAGCCTTAGCAGCCTTAAACTCTGCATTTAACTCATCATTTGGAACCAAATTTTATACTCCTAGGCCATCTGGAAGAGGTCAAGGATCACAAAAAGCAGCAGCAGTAGCTGCTCTCTCTTCAGTTCTTACTGCTAAAAAGAAGAAAACTTCACCTAAAACTTCTCCTGTGGCTAGCACTAACACTAAAAGTGAAAGTGCCCCTTCTAAAATGGAAGTTGTTGAAGAAGTTGCAGATGTCAAAGAGACAGAAGAAGTTGCCCCTGAAACTGGTACCAATGGGGATTCAGAACAACCAAAACAAGAAAATGTAGAGGATGGAAGAAATGATAGTGAAAATAATAATCTTAATGTCTTCAGTTATGAGCAATTAAAGACTAAATCTGGTAGTGCTTATCTGTCAGACAAAGAGTTCGAAATTGTATTTGGAATGACCAAAGAAGCATTCTCTAAGTTGCCAAGATGGAAGCAAGACATGCTGAAAAGGAAAGTGGATTTGTTCTAG

Predicted protein sequences of Glyma04g32770

Limit To All Plant Sequences

>Glyma04g32770.1   sequence type=predicted peptide   gene model=Glyma04g32770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GPRQRAEALATLNNAFNSSPETTSSAIPLIGKGGHRDKLNGLNRGGPRQRAEALAALNSAFNSSFGTKFYTPRPSGRGQGSQKAAAVAALSSVLTAKKKKTSPKTSPVASTNTKSESAPSKMEVVEEVADVKETEEVAPETGTNGDSEQPKQENVEDGRNDSENNNLNVFSYEQLKTKSGSAYLSDKEFEIVFGMTKEAFSKLPRWKQDMLKRKVDLF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain