SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g32515

Feature Type:gene_model
Chromosome:Gm04
Start:37333923
stop:37335181
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g32515
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G19985AT Annotation by Michelle Graham. TAIR10: Acyl-CoA N-acyltransferases (NAT) superfamily protein | chr4:10830542-10831711 REVERSE LENGTH=237 SoyBaseE_val: 9.00E-50ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0008080GO-mf Annotation by Michelle Graham. GO Molecular Function: N-acetyltransferase activity SoyBaseN/AISS
PF00583PFAM Acetyltransferase (GNAT) family JGI ISS
UniRef100_G7J9R3UniRef Annotation by Michelle Graham. Most informative UniRef hit: N-acetyltransferase, putative n=1 Tax=Medicago truncatula RepID=G7J9R3_MEDTR SoyBaseE_val: 5.00E-68ISS
UniRef100_UPI000233A06AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A06A related cluster n=1 Tax=unknown RepID=UPI000233A06A SoyBaseE_val: 4.00E-113ISS

Expression Patterns of Glyma04g32515
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g32515 not represented in the dataset
Glyma04g32515 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g32515 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g163300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g32515
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g32515
>Glyma04g32515.1   sequence type=CDS   gene model=Glyma04g32515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACAAGCAAAAGCTCTCAGCTCGAGAAGATGAAGAAGCTATCATCAAAACCACCTTTCCCAATTTACATTTCTACCGACCCACGCCATGTGGACCCGCACCGTCTCCAAGACCTCTTCCTCCGCATTGCACTGTCTCACAGTTCCGTTCTTGTCTCCGTCTTCTGCAACCCCCAACATGTAAACGCCGTTTTCCATCAGAATTCATCATCGTCTTCAATCGCGGATATCTTCATGCCAGTTTCTCCTTCACGGGATCAATTGGTCAGGTTTGGCCATGCCCTTTTCGAGTATGGCCTCACCGCTTCTATTTACGATGTCATGGTTATTCCTTCCCTGCAAAGAATGGGAATTGGTCAAATGATAGTTAAAAAAATTGTTAGAATGCTTACAAATAGAGACATCTATGACATAGCAGCCCTTTGTTCGGGGAATGAAAGGTTATTTTTTGAGGCGTGTGGATTTGGGGATGACATTTTGGGCTCTACTACCATGATGTATAGGAGAACTGCTCCATTAACAATCCAGGAAGGTGAATAG
Predicted protein sequences of Glyma04g32515
>Glyma04g32515.1   sequence type=predicted peptide   gene model=Glyma04g32515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TSKSSQLEKMKKLSSKPPFPIYISTDPRHVDPHRLQDLFLRIALSHSSVLVSVFCNPQHVNAVFHQNSSSSSIADIFMPVSPSRDQLVRFGHALFEYGLTASIYDVMVIPSLQRMGIGQMIVKKIVRMLTNRDIYDIAALCSGNERLFFEACGFGDDILGSTTMMYRRTAPLTIQEGE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo