SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g30971): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g30971): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g30971

Feature Type:gene_model
Chromosome:Gm04
Start:35178691
stop:35196017
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g30971
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G04180AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr4:2020471-2023673 FORWARD LENGTH=609 SoyBaseE_val: 2.00E-29ISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
UniRef100_B9RXE9UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S protease regulatory subunit, putative n=1 Tax=Ricinus communis RepID=B9RXE9_RICCO SoyBaseE_val: 1.00E-27ISS
UniRef100_UPI000233A945UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A945 related cluster n=1 Tax=unknown RepID=UPI000233A945 SoyBaseE_val: 6.00E-98ISS

Expression Patterns of Glyma04g30971
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g30971 not represented in the dataset
Glyma04g30971 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g30971 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g157800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g30971
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g30971
>Glyma04g30971.1   sequence type=CDS   gene model=Glyma04g30971   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATTCTTGGAAGCTGCATATGTGGATAACGGTGCTGTGGATGTCCAAGAAAGTGCTAAGAAGGAACGTGAGCGAATTGAGGAGTTGCTTAGAAGTAGAGGAATTAGATATGGCTCTTACCCTCGTTTCACTGTTTACGTTAAAGGCCAAAAGGTCAGTATTAAGTTTCAAATTCCTCCTAATTGTGAAGTTTCACAACTTATCGCAAATCTTACTGCACATCTTGGAACAAAAGCTGAAGGCCATGGTGGTGGTTCAGACATGTTATTACGAGCTTGGGACAGGCTCCATGAGGAGTTCTTTCTTCGAGGGGAAGTTATAATGGAACAAGGAAATGTTGTGGATCAACTATATTTTGTCTGCCATGGAGTAATGGTTGTTTGGAATTATTATCTTCGAAGGCCGTTCGCATGA
Predicted protein sequences of Glyma04g30971
>Glyma04g30971.1   sequence type=predicted peptide   gene model=Glyma04g30971   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFLEAAYVDNGAVDVQESAKKERERIEELLRSRGIRYGSYPRFTVYVKGQKVSIKFQIPPNCEVSQLIANLTAHLGTKAEGHGGGSDMLLRAWDRLHEEFFLRGEVIMEQGNVVDQLYFVCHGVMVVWNYYLRRPFA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo