|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G07910 | AT | Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Reactive oxygen species modulator 1 (InterPro:IPR018450); Has 192 Blast hits to 192 proteins in 80 species: Archae - 0; Bacteria - 0; Metazoa - 139; Fungi - 6; Plants - 39; Viruses - 0; Other Eukaryotes - 8 (source: NCBI BLink). | chr3:2523367-2524048 REVERSE LENGTH=74 | SoyBase | E_val: 1.00E-16 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| KOG4096 | KOG | Uncharacterized conserved protein | JGI | ISS | |
| PF10247 | PFAM | Reactive mitochondrial oxygen species modulator 1 | JGI | ISS | |
| UniRef100_I1JWI6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1JWI6_SOYBN | SoyBase | E_val: 4.00E-40 | ISS |
| UniRef100_Q9SFC3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: AT3g07910/F17A17_25 n=1 Tax=Arabidopsis thaliana RepID=Q9SFC3_ARATH | SoyBase | E_val: 5.00E-14 | ISS |
|
Glyma04g28760 not represented in the dataset |
Glyma04g28760 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.04g138500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma04g28760.2 sequence type=CDS gene model=Glyma04g28760 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTAGAGACAGCGTCCTAACACGCGTGGCGACCGGAGCCGCCGTTGGCGGTGCTATCGGCGGCGCAGTCGGTGCTGTTTATGGGACTTACGATGCAATTAGGTATAAGGTTCCTGGACTCCTCAAGATAAGGCATATAGGGCAGACCACTCTGGGAAGTGCAGCTGTATTTAGCTTGTTCCTAGCGGCAGGAACCTTGATACGATCTCACTAG
>Glyma04g28760.2 sequence type=predicted peptide gene model=Glyma04g28760 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MARDSVLTRVATGAAVGGAIGGAVGAVYGTYDAIRYKVPGLLKIRHIGQTTLGSAAVFSLFLAAGTLIRSH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||