SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g28550

Feature Type:gene_model
Chromosome:Gm04
Start:32800266
stop:32801084
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g28550
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33550AT Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr4:16134538-16134964 FORWARD LENGTH=115 SoyBaseE_val: 4.00E-21ISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0008289GO-mf Annotation by Michelle Graham. GO Molecular Function: lipid binding SoyBaseN/AISS
PF00234PFAM Protease inhibitor/seed storage/LTP family JGI ISS
UniRef100_G7JQJ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Seed specific protein Bn15D18B n=1 Tax=Medicago truncatula RepID=G7JQJ7_MEDTR SoyBaseE_val: 6.00E-23ISS
UniRef100_I1JWI3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JWI3_SOYBN SoyBaseE_val: 4.00E-75ISS

Expression Patterns of Glyma04g28550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g28550 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g138700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g28550
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g28550
>Glyma04g28550.1   sequence type=CDS   gene model=Glyma04g28550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAAGGATGCTCAATACCAACCTTGTGATGATTTTGGCCATCATCGGAATCCTAGCGTTTTCTAGTGCCAACAATGTTGTTGTGGGGCAGTGTCCAGGCATGGAGGGCCTCATAACCCAATGTTCGGAGTATGTTGAGAAGTCTGGCCCTGAGATGAGTCCATCGCCACAGTGCTGCCACGAGATCGAGAACGCGGACACTCCATGTCTGTGTCAGCACTTCAACAAGGCAATCCTGCAGTTTATTGACATTCAGAAGGTCATTTATGTTGCCAGGTCGTGTGGAAAGCCAATACCCTCTGGAACCACTTGTGGAGGTGTTACGGTGTCATGA
Predicted protein sequences of Glyma04g28550
>Glyma04g28550.1   sequence type=predicted peptide   gene model=Glyma04g28550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTRMLNTNLVMILAIIGILAFSSANNVVVGQCPGMEGLITQCSEYVEKSGPEMSPSPQCCHEIENADTPCLCQHFNKAILQFIDIQKVIYVARSCGKPIPSGTTCGGVTVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo