SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g28451

Feature Type:gene_model
Chromosome:Gm04
Start:32664903
stop:32666886
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g28451
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18370AT Annotation by Michelle Graham. TAIR10: C2 domain-containing protein | chr3:6306362-6310256 FORWARD LENGTH=815 SoyBaseE_val: 1.00E-29ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00168PFAM C2 domain JGI ISS
UniRef100_G7L9Q9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plant synaptotagmin n=1 Tax=Medicago truncatula RepID=G7L9Q9_MEDTR SoyBaseE_val: 1.00E-49ISS
UniRef100_UPI000233882DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233882D related cluster n=1 Tax=unknown RepID=UPI000233882D SoyBaseE_val: 2.00E-74ISS

Expression Patterns of Glyma04g28451
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g28451 not represented in the dataset
Glyma04g28451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g28451 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g139000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g28451
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g28451
>Glyma04g28451.1   sequence type=CDS   gene model=Glyma04g28451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAACGTTCATCATGCCTACACTTTTTTTGCTGTTGTTCATTGTGTTTAACATCGGTGCAAATGTAAATTTGGAAGGACTGGGGGACGGGTCAATCAAGGTTGAATGGATCCCTCATGAAGGAGTGATAGTTAAGGTGGAGGACCAAGAAGGATCAAGGGGTTCAACTAATGGTTGGATAGAACTTGTTGTGATTGAAGCGAGGGATCTTATTGCTGCTGATCTTCGTGGGACAAGTGATCCTTATGTAAGGGTAAACTATGGAAACTCGAAGAAAAGGACAAAGGTTAGAATATTTTTACTGCGAATGTGTGTAGAATATCAAAGGTTGCCTCCAAACCAGATGTCTGACAAGTGGATACCTCTGCAAGGGGTGAAAAGTGGTGAGATCCACATCCAAATTACAAGAAAAGTTCCAGAAATGCAAACAAGACATACTCTAGACTCTCATCCTTCTTCGTTAAGTAAATCACACCAAATTCCTACCCGGGAGAGATAA
Predicted protein sequences of Glyma04g28451
>Glyma04g28451.1   sequence type=predicted peptide   gene model=Glyma04g28451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTFIMPTLFLLLFIVFNIGANVNLEGLGDGSIKVEWIPHEGVIVKVEDQEGSRGSTNGWIELVVIEARDLIAADLRGTSDPYVRVNYGNSKKRTKVRIFLLRMCVEYQRLPPNQMSDKWIPLQGVKSGEIHIQITRKVPEMQTRHTLDSHPSSLSKSHQIPTRER*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo