SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g27220

Feature Type:gene_model
Chromosome:Gm04
Start:31211683
stop:31212698
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g27220
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G09020AT Annotation by Michelle Graham. TAIR10: isoamylase 3 | chr4:5784099-5788839 FORWARD LENGTH=764 SoyBaseE_val: 2.00E-33ISS
GO:0000272GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide catabolic process SoyBaseN/AISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0005983GO-bp Annotation by Michelle Graham. GO Biological Process: starch catabolic process SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009569GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast starch grain SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0004556GO-mf Annotation by Michelle Graham. GO Molecular Function: alpha-amylase activity SoyBaseN/AISS
GO:0019156GO-mf Annotation by Michelle Graham. GO Molecular Function: isoamylase activity SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PTHR10357Panther AMYLASE JGI ISS
PTHR10357:SF74Panther gb def: amylosucrase [neisseria polysaccharea] JGI ISS
UniRef100_A4PIT0UniRef Annotation by Michelle Graham. Best UniRef hit: Isoamylase-type starch-debranching enzyme 3 n=1 Tax=Phaseolus vulgaris RepID=A4PIT0_PHAVU SoyBaseE_val: 3.00E-35ISS
UniRef100_A4PIT0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Isoamylase-type starch-debranching enzyme 3 n=1 Tax=Phaseolus vulgaris RepID=A4PIT0_PHAVU SoyBaseE_val: 3.00E-35ISS

Expression Patterns of Glyma04g27220
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g27220 not represented in the dataset
Glyma04g27220 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g27220 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g140700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g27220
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g27220
>Glyma04g27220.1   sequence type=CDS   gene model=Glyma04g27220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGTAGAAGAATACCGTTTTTGAGGACAATAGTTGACTCTTCGGTGATTTACTGTAGGCCATACCATAGTATTAACTTTGTTATTGCACATGACGGATTCACCTTGCGTGATCTTGTTTCATATAATTTCAAGCATAATGAAGCCAATGGGGAAGGTGGAAATGACGGAAGCAATGATAATTTCAGTTGGAATTGTGGTTTCAAAGGGGAAACTGATGATGCTAGTATAAGAGCTTTTCGATCATGGCAAATGAAAAATTGA
Predicted protein sequences of Glyma04g27220
>Glyma04g27220.1   sequence type=predicted peptide   gene model=Glyma04g27220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSRRIPFLRTIVDSSVIYCRPYHSINFVIAHDGFTLRDLVSYNFKHNEANGEGGNDGSNDNFSWNCGFKGETDDASIRAFRSWQMKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo