SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g26831

Feature Type:gene_model
Chromosome:Gm04
Start:30785042
stop:30786411
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g26831
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62460AT Annotation by Michelle Graham. TAIR10: RING/FYVE/PHD zinc finger superfamily protein | chr5:25075545-25077072 FORWARD LENGTH=307 SoyBaseE_val: 1.00E-28ISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR23012Panther MEMBRANE ASSOCIATED RING FINGER JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_G7KF81UniRef Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase MARCH3 n=1 Tax=Medicago truncatula RepID=G7KF81_MEDTR SoyBaseE_val: 1.00E-36ISS
UniRef100_I1JWG3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JWG3_SOYBN SoyBaseE_val: 1.00E-78ISS

Expression Patterns of Glyma04g26831
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g26831 not represented in the dataset
Glyma04g26831 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g26831 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g26831
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g26831
>Glyma04g26831.1   sequence type=CDS   gene model=Glyma04g26831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGCGATCACTTGGTGGTGTTCGTTGACTGTCTTGCACGCCCTGTCCCTGTTGATCCAGTGGCGCAGACGACCCAGGTGCCTTTCGAACCATCTCCACCTCCGGCCGTCGTGGATGCTGACGCCGCTGGGAGCTCCGACACCTCACCGTCGGAGGATTGCGACGACGAGGGCGACGACGAGGAGGAGCAGCTGATCCAGATGGCAGAGTGTCATATCTGCCAGGAGGAGGATGGCGTTTCCAACTTGGAGACACCCTGCGCCTGTAGCGGCAGTCTTAAGTATGCTCACAGAAAGTGTGTCCAACATTGGTGTGATGAGAAAGGAGACATAACTTGTGAGATATGTCATCATGTATGCTTTTTGCACAAT
Predicted protein sequences of Glyma04g26831
>Glyma04g26831.1   sequence type=predicted peptide   gene model=Glyma04g26831   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDHLVVFVDCLARPVPVDPVAQTTQVPFEPSPPPAVVDADAAGSSDTSPSEDCDDEGDDEEEQLIQMAECHICQEEDGVSNLETPCACSGSLKYAHRKCVQHWCDEKGDITCEICHHVCFLHN






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo