Glyma04g26730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g26730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g26730): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g26730

Feature Type:	gene_model
Chromosome:	Gm04
Start:	30665608
stop:	30667649
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma04g26730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G04510	AT	Annotation by Michelle Graham. TAIR10: MOS4-associated complex 3A \| chr1:1226749-1230592 FORWARD LENGTH=523	SoyBase	E_val: 3.00E-38	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0080008	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
PTHR13889	Panther	WD40 REPEAT PROTEIN	JGI		ISS
PTHR13889:SF9	Panther	SNRNP - RELATED	JGI		ISS
PF00400	PFAM	WD domain, G-beta repeat	JGI		ISS
UniRef100_G7I632	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA-processing factor-like protein n=1 Tax=Medicago truncatula RepID=G7I632_MEDTR	SoyBase	E_val: 3.00E-40	ISS
UniRef100_I1LAQ3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LAQ3_SOYBN	SoyBase	E_val: 2.00E-49	ISS

Expression Patterns of Glyma04g26730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g26730 not represented in the dataset	Glyma04g26730 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g26730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma04g26730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma04g26730

Limit To All Plant Sequences

>Glyma04g26730.1   sequence type=CDS   gene model=Glyma04g26730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAGGCTCTTCCTCAAAAAAGGAGGAAACAAATTCCTGCAACTTTGGCTCATGTTGAAGCTCTAGAGGCATATACCCAGATATCTAGTCATCCCTTTCACAAAACAAACAAACAAGACATTATATCTCTTGATATCCTTTATTCTAAGGACTTAATTGCAACTGGAGGTATTGATACAAATGTTGTTATTTTTTACCGCCCATCAGGACAGATATTATCTACACTCAGCGATCACTCTAAAAAGGTGACCAGTGTAAAGTTTGTAGCTCAGGGTGAATCATTCATAACTGCTTCAGCAAATAAGTCCACTCAATATTTTTTAGTCTCTTGCAATTTACTTTTGCATTTTGTTTTTATTTTGTTAAAACATAAGCACTTAGACAATGAAGGAAAGCTGGAGTTGTTGCACATGATGTCCAACGTTATGTCCAGGACATCCTGCCCGAAAATACTGGAGTTGCTGCACAATGCACAAGGCAAGATAAAAGTCAAATGA

Predicted protein sequences of Glyma04g26730

Limit To All Plant Sequences

>Glyma04g26730.1   sequence type=predicted peptide   gene model=Glyma04g26730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKALPQKRRKQIPATLAHVEALEAYTQISSHPFHKTNKQDIISLDILYSKDLIATGGIDTNVVIFYRPSGQILSTLSDHSKKVTSVKFVAQGESFITASANKSTQYFLVSCNLLLHFVFILLKHKHLDNEGKLELLHMMSNVMSRTSCPKILELLHNAQGKIKVK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain