SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g26730

Feature Type:gene_model
Chromosome:Gm04
Start:30665608
stop:30667649
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g26730
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04510AT Annotation by Michelle Graham. TAIR10: MOS4-associated complex 3A | chr1:1226749-1230592 FORWARD LENGTH=523 SoyBaseE_val: 3.00E-38ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
PTHR13889Panther WD40 REPEAT PROTEIN JGI ISS
PTHR13889:SF9Panther SNRNP - RELATED JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_G7I632UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA-processing factor-like protein n=1 Tax=Medicago truncatula RepID=G7I632_MEDTR SoyBaseE_val: 3.00E-40ISS
UniRef100_I1LAQ3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LAQ3_SOYBN SoyBaseE_val: 2.00E-49ISS

Expression Patterns of Glyma04g26730
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g26730 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma04g26730
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g26730
>Glyma04g26730.1   sequence type=CDS   gene model=Glyma04g26730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGAAGGCTCTTCCTCAAAAAAGGAGGAAACAAATTCCTGCAACTTTGGCTCATGTTGAAGCTCTAGAGGCATATACCCAGATATCTAGTCATCCCTTTCACAAAACAAACAAACAAGACATTATATCTCTTGATATCCTTTATTCTAAGGACTTAATTGCAACTGGAGGTATTGATACAAATGTTGTTATTTTTTACCGCCCATCAGGACAGATATTATCTACACTCAGCGATCACTCTAAAAAGGTGACCAGTGTAAAGTTTGTAGCTCAGGGTGAATCATTCATAACTGCTTCAGCAAATAAGTCCACTCAATATTTTTTAGTCTCTTGCAATTTACTTTTGCATTTTGTTTTTATTTTGTTAAAACATAAGCACTTAGACAATGAAGGAAAGCTGGAGTTGTTGCACATGATGTCCAACGTTATGTCCAGGACATCCTGCCCGAAAATACTGGAGTTGCTGCACAATGCACAAGGCAAGATAAAAGTCAAATGA
Predicted protein sequences of Glyma04g26730
>Glyma04g26730.1   sequence type=predicted peptide   gene model=Glyma04g26730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKALPQKRRKQIPATLAHVEALEAYTQISSHPFHKTNKQDIISLDILYSKDLIATGGIDTNVVIFYRPSGQILSTLSDHSKKVTSVKFVAQGESFITASANKSTQYFLVSCNLLLHFVFILLKHKHLDNEGKLELLHMMSNVMSRTSCPKILELLHNAQGKIKVK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo