SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g26715): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g26715): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g26715

Feature Type:gene_model
Chromosome:Gm04
Start:30650879
stop:30653768
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54490AT Annotation by Michelle Graham. TAIR10: RNA polymerase II fifth largest subunit, E | chr3:20173673-20175297 FORWARD LENGTH=233 SoyBaseE_val: 2.00E-51ISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003899GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity SoyBaseN/AISS
KOG3218 KOG RNA polymerase, 25-kDa subunit (common to polymerases I, II and III) JGI ISS
PTHR10535Panther DNA-DIRECTED RNA POLYMERASE II JGI ISS
PF01191PFAM RNA polymerase Rpb5, C-terminal domain JGI ISS
PF03871PFAM RNA polymerase Rpb5, N-terminal domain JGI ISS
UniRef100_Q2HW77UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase subunit, RPB5; RNA polymerase Rpb5, N-terminal n=1 Tax=Medicago truncatula RepID=Q2HW77_MEDTR SoyBaseE_val: 1.00E-68ISS
UniRef100_UPI000233D2C9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D2C9 related cluster n=1 Tax=unknown RepID=UPI000233D2C9 SoyBaseE_val: 2.00E-109ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g26715 not represented in the dataset

Glyma04g26715 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g141500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma04g26715.1   sequence type=CDS   gene model=Glyma04g26715   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCCAAGACAGAGGTTACGATGCCATTCAGCATGCAAACATTTCTCCCTCCCTCACCGAGTTCTGCTCCCGCTTCAGCCAAAACCCCAACCCCCAAACCCTCGACTTTTGTGTTCCGCATCTCTCTAACACAGTACAGGTTGTGTTTGTGGGGCCCAAGGAAATAAGAAAAGGGACAGTGAATGAGATATGTAGCCAGATTGCGGACAAGGGAAGCTTGAAATGGCTGATACTCGTTGTTAAGAGTAAAATGACTTCGTTTGCAAAGAAAGACTTGGAGAATTTTCCATTTAAAGTTGAGACTATCAAAATTGATGATTTGCTGGTCAATATCACAAAGCATGTGTTGCAGCCAAAGTATGAGATACTTACTGATGATGAGAAGCAAGCATTGCTCACCAAGCATAATTTGGATGAGAAGCAGCTCCCTCACATGTTGAAAACTGATACCATAGCTCGCTACTATGGGCTGGAGAAAGGGCAAGTTGTGAAAATCACTCACAGTGGTCCAGTGGTTAATTTTGATGTGTCTTACCGTTGTGTCGTGTAA

>Glyma04g26715.1   sequence type=predicted peptide   gene model=Glyma04g26715   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLQDRGYDAIQHANISPSLTEFCSRFSQNPNPQTLDFCVPHLSNTVQVVFVGPKEIRKGTVNEICSQIADKGSLKWLILVVKSKMTSFAKKDLENFPFKVETIKIDDLLVNITKHVLQPKYEILTDDEKQALLTKHNLDEKQLPHMLKTDTIARYYGLEKGQVVKITHSGPVVNFDVSYRCVV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo