SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma04g26650

Feature Type:gene_model
Chromosome:Gm04
Start:30562244
stop:30562998
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g26650
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G24310AT Annotation by Michelle Graham. TAIR10: myb domain protein 305 | chr3:8811336-8812330 REVERSE LENGTH=269 SoyBaseE_val: 8.00E-68ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_G7I6P8UniRef Annotation by Michelle Graham. Most informative UniRef hit: R2R3-MYB transcription factor n=1 Tax=Medicago truncatula RepID=G7I6P8_MEDTR SoyBaseE_val: 4.00E-70ISS
UniRef100_I1JWF5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JWF5_SOYBN SoyBaseE_val: 1.00E-81ISS

Expression Patterns of Glyma04g26650
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g26650 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g141700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g26650
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g26650
>Glyma04g26650.1   sequence type=CDS   gene model=Glyma04g26650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGGAAACATGGGGTGGGGTGTGATAGAAGAGGAGGGATGGAGGAAGGGACCTTGGACTTCTGAGGAGGACAGATTGCTCATTCTGTATGTCAAGTTCCATGGTGAGGGCAGATGGAACTCTGCTGCTAGGCTTGCAGGACTAAAAAGAAATGGGAAGAGCTGCAGATTGAGATGGGTGAATTACCTGAGGCCAGACCTCGAGAAGGGTCAAATAACACCACAAGAAGAAAGCATAATTCTAGAGCTGCATGCTAGGTGGGGAAATAGGTGGTCAACAATTGCAAGAAGCTTGCCAGGAAGAACTGACAATGAGATAAAGAATTATTGGAGGACTCACTTCAAGAAAAAGATAAGGGCTCACTTCAGCTAA
Predicted protein sequences of Glyma04g26650
>Glyma04g26650.1   sequence type=predicted peptide   gene model=Glyma04g26650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGNMGWGVIEEEGWRKGPWTSEEDRLLILYVKFHGEGRWNSAARLAGLKRNGKSCRLRWVNYLRPDLEKGQITPQEESIILELHARWGNRWSTIARSLPGRTDNEIKNYWRTHFKKKIRAHFS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo