SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma04g25800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma04g25800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma04g25800

Feature Type:gene_model
Chromosome:Gm04
Start:29747109
stop:29748098
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma04g25800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13780AT Annotation by Michelle Graham. TAIR10: Acyl-CoA N-acyltransferases (NAT) superfamily protein | chr5:4447610-4448603 REVERSE LENGTH=192 SoyBaseE_val: 1.00E-105ISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0051604GO-bp Annotation by Michelle Graham. GO Biological Process: protein maturation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008080GO-mf Annotation by Michelle Graham. GO Molecular Function: N-acetyltransferase activity SoyBaseN/AISS
KOG3235 KOG Subunit of the major N alpha-acetyltransferase JGI ISS
PTHR23091Panther N-TERMINAL ACETYLTRANSFERASE JGI ISS
PTHR23091:SF4Panther N-TERMINAL ACETYLTRANSFERASE COMPLEX ARD1 SUBUNIT JGI ISS
PF00583PFAM Acetyltransferase (GNAT) family JGI ISS
UniRef100_B7FJ76UniRef Annotation by Michelle Graham. Most informative UniRef hit: N-terminal acetyltransferase complex ARD1 subunit-like protein n=1 Tax=Medicago truncatula RepID=B7FJ76_MEDTR SoyBaseE_val: 1.00E-110ISS
UniRef100_I1JWF0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWF0_SOYBN SoyBaseE_val: 1.00E-135ISS

Expression Patterns of Glyma04g25800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma04g25800 not represented in the dataset
Glyma04g25800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma04g25800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.04g142300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma04g25800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma04g25800
>Glyma04g25800.1   sequence type=CDS   gene model=Glyma04g25800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTGCATAAGGAAGGCGACGGTGAAGGACCTTCTGGCGATGCAGGCGTGCAACCTGTTCTGCCTCCCTGAGAACTACCAGATGAAGTACTACCTCTATCACATCCTCTCCTGGCCCCAGCTCCTCTACGTCGCCGAAGACTACAACGGCCGCATCGTCGGCTACGTCCTCGCCAAGATGGAGGAAGAGACCACTGACTGCCACGGCCACATCACCTCCCTCGCCGTCCTCCGCACCCACCGCAAGCTAGGCCTCGCCACTAAGCTCATGACCGCCGCCCAGAACGCCATGGAACAGGTGTTTGGTGCCGAGTACGTGTCCCTGCACGTGCGCAAGAGCAACCGCGCGGCCTTCAATTTGTACACGGAGACTCTAGGGTACAAGATTCATGATGTGGAGGCCAAGTATTATGCGGACGGGGAGGATGCTTACGACATGAGGAAGCAGCTCAAGGGGAAGCAGCACCACCATCATCACCATCACCACCACCACCGTCACGAGCACGGCGGTGGCTGTTGTTCCGGGGAGCCCAAGGGGAATGTTGCAAAAGCCACCTGA
Predicted protein sequences of Glyma04g25800
>Glyma04g25800.1   sequence type=predicted peptide   gene model=Glyma04g25800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVCIRKATVKDLLAMQACNLFCLPENYQMKYYLYHILSWPQLLYVAEDYNGRIVGYVLAKMEEETTDCHGHITSLAVLRTHRKLGLATKLMTAAQNAMEQVFGAEYVSLHVRKSNRAAFNLYTETLGYKIHDVEAKYYADGEDAYDMRKQLKGKQHHHHHHHHHHRHEHGGGCCSGEPKGNVAKAT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo